KEGG   Haloterrigena salifodinae: JMJ58_24075
Entry
JMJ58_24075       CDS       T07070                                 

Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
hsal  Haloterrigena salifodinae
Pathway
hsal00630  Glyoxylate and dicarboxylate metabolism
hsal01100  Metabolic pathways
hsal01120  Microbial metabolism in diverse environments
hsal01200  Carbon metabolism
Module
hsal_M00740  Methylaspartate cycle
Brite
KEGG Orthology (KO) [BR:hsal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JMJ58_24075
Enzymes [BR:hsal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     JMJ58_24075
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     JMJ58_24075
SSDB
Motif
Pfam: HpcH_HpaI
Other DBs
NCBI-ProteinID: QRV17868
LinkDB
Position
pHTS280.6:complement(235091..236401)
AA seq 436 aa
MSTHTDRLHDREFVRTFFTTPTAVKGEDDSAKMLRRAAQLSGIEAPDVWVPDNEDATAPS
MRDEGIENIIDVLSEDGDNVPGEVHPRVVWHRESPETRYQGFQQILELADPENDAVEHLD
GVVIPEVGDIDDWKKADEFITIVENEHGLEEGSLAMSVIVESGEAELALGDLREEMGKPS
NNLERLFLLVDGEVDYTKDMRAITPTGELPPWPELRHNTSRGASAAGLIAIDGPYDDIRD
VEGYHERMTDNQAKGMLGIWSLTPGQVVEANKSPLPPKNGSWLLEVDDREIELEAEDGRY
VYEGDAIELEEATDDQYRLSVGGDERELDGDELSQELLDLASYIPSLNDIVDSMEEFEAA
KEAGKGAIAMERSVTIVIDGVEVEISNDRMWDEATYQAAQTPITLFQDVYENRPDQHEDL
EEMYGEDLVERAMVVG
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagtacgcacactgatcgccttcacgatcgggagttcgttcggacgttctttacgacc
ccgacggccgtgaaaggagaagacgattccgccaagatgctgcgccgtgccgcccagctt
agcggcatcgaagcgccggacgtctgggtgccagacaacgaggacgcgacggctccgtcg
atgcgcgacgaagggatcgagaacatcatcgacgtgttgtccgaagacggcgacaacgtc
cccggcgaggtccacccccgcgtcgtctggcaccgcgagagccccgagacccgataccag
ggcttccagcaaatcctcgagctcgcagatcccgaaaacgacgccgtcgaacacctcgac
ggcgtcgtgattccggaagtcggcgacatcgacgactggaagaaggccgacgagttcatc
accatcgtcgagaacgagcacggactggaggagggtagtctggccatgtcggtcatcgtc
gagagcggcgaggccgaactggcgctcggcgacctccgcgaggagatgggcaagccctcg
aacaacttagagcggctgttcctcctcgtcgacggcgaggtcgactacaccaaggacatg
cgcgcgatcacgccgactggcgaactgccgccgtggccggagctgcgacacaacacctcc
cgcggcgcgagcgcggctggactgatcgcaatcgacggcccgtacgacgacatccgcgat
gtcgagggctaccacgagcggatgaccgacaaccaggcgaaggggatgctcggaatctgg
tcgctgacccccggtcaggtcgtcgaggcaaacaagtcaccgctcccgccgaagaacgga
agctggcttctcgaggtcgacgaccgcgagatcgaactcgaagcggaggacggtcgctac
gtttacgagggcgacgcgatcgaactcgaagaagcgacagacgaccagtacagactcagc
gtcggcggcgacgagcgcgaactcgacggcgacgaactctcccaggagcttctggatctg
gcctcctacatcccgagtctgaacgacatcgtcgactcgatggaagagttcgaagcggcc
aaggaagccggaaagggtgcgatcgcgatggagcgatcggtgaccatcgtcatcgacggc
gtcgaggtcgagatcagcaatgaccgaatgtgggacgaggctacctaccaggcggcccag
accccgatcacgctgttccaggacgtctacgagaaccggccggaccaacacgaggaccta
gaggagatgtacggcgaggacctcgtggagcgcgcgatggtggtcggctga

DBGET integrated database retrieval system