Hydrogenobacter thermophilus: Hydth_0489 Help Entry Hydth_0489        CDS       T02106                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism hte  Hydrogenobacter thermophilus Pathway hte02024   Quorum sensing hte03018   RNA degradation Brite KEGG Orthology (KO) [BR:hte00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Hydth_0489  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Hydth_0489  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hte03019]     Hydth_0489    03036 Chromosome and associated proteins [BR:hte03036]     Hydth_0489 Messenger RNA biogenesis [BR:hte03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Hydth_0489 Chromosome and associated proteins [BR:hte03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Hydth_0489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 DUF5608 LSM Motif Other DBs NCBI-ProteinID:  ADO44890 UniProt:  D3DGK3 LinkDB All DBs Position 482361..482603 Genome browser AA seq 80 aa AA seqDB search MPYKLQESFLNTARKRRVKVTIYLVNGVRLQGRVRSFDLYTILIEDGRQQTLVYKHAITT IIPAEKLEIEFEEEGVPGAV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccctataagctacaggagagctttctaaacacagcaaggaagagaagggtcaaggtg accatatatttggtgaatggcgtcaggcttcagggaagggtaagatcctttgacctttac accatacttatagaggacggtcggcagcagacgctggtttataagcacgccataactacc ataatacctgctgaaaagcttgagattgaatttgaggaggaaggagtgccgggggctgtg taa

DBGET integrated database retrieval system