KEGG   Hydrogenobacter thermophilus: HTH_0311
Entry
HTH_0311          CDS       T01167                                 

Symbol
ccl
Name
(GenBank) citryl-CoA lyase
  KO
K15234  citryl-CoA lyase [EC:4.1.3.34]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00720  Carbon fixation pathways in prokaryotes
hth01100  Metabolic pathways
hth01120  Microbial metabolism in diverse environments
hth01200  Carbon metabolism
Module
hth_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:hth00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_0311 (ccl)
Enzymes [BR:hth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     HTH_0311 (ccl)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: BAI68778
UniProt: D3DG26
LinkDB
Position
316383..317162
AA seq 259 aa
MERIWKTGITQHIGHETYIRGYRLLDLVGNLSFAQAIYLILKGELPTERESRMMEAMLVS
VIDHGIAPPSAIAARSVASGGNSLNVGVAAGVLAFGSAHGGALEDAMRFIQEGVSSKRSV
EDIVKEYLETKKPIPGYGHRYYKDFDPRTKRLMDIARVLEFYGEHCKFAEDVAEEIGRQK
GKKLVLNVDGAIAAIASEMGFDWRLGKGFFIIGRVPGLVAHVYEELTTEKPFSKRLDEER
DVEYTGSPPRELPQELKKI
NT seq 780 nt   +upstreamnt  +downstreamnt
atggagagaatttggaagacaggcataacccagcatattggacacgagacatacatcaga
ggctatcggcttcttgatcttgtaggtaatctctcctttgcacaggctatctatctgata
ctcaaaggcgaactcccaacagaaagggagagtaggatgatggaagctatgctggtgtct
gttattgaccacggtatagcaccaccttctgctattgcggcaaggtctgtggcatcaggt
ggtaactctttgaatgtgggggttgcggctggtgtgttagcttttgggtccgctcacggg
ggagctcttgaagatgccatgaggtttatccaagagggagtgtcaagcaaaagaagcgtt
gaagatatagtaaaagagtatttagagaccaaaaagcctatacctggctacggacacagg
tactacaaggactttgacccacgaacaaaaaggcttatggacatagccagagttctggag
ttttacggagagcactgtaagtttgcagaggatgtggccgaagagataggcaggcaaaaa
ggtaaaaagctggtgctgaatgtggacggtgctatagctgcgatagcttccgagatgggc
tttgactggaggctcggcaagggcttttttatcataggaagagttcccggacttgtagca
catgtttatgaagagctcaccacagagaaacctttctctaagagattagatgaagagagg
gatgtggagtatacgggatcgcctcccagagaacttcctcaagagcttaaaaagatataa

DBGET integrated database retrieval system