KEGG   Haloterrigena turkmenica: Htur_2413
Entry
Htur_2413         CDS       T01154                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00053  Ascorbate and aldarate metabolism
htu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:htu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Htur_2413
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     Htur_2413
SSDB
Motif
Pfam: Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 DapB_N GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: ADB61291
UniProt: D2RV90
LinkDB
Position
2481865..2482635
AA seq 256 aa
MTEIAITGASGRVGRQSIEAFDDETLTLFSHSESEDLDTETLEIANRDEFVEALEGQDVL
IHLAANPSPRAEWDEVREPNVDGVYNAFHAAVENDLERVVFASSNHAVNMSNVVSPIRPE
STVGKPDIVRPDDEMDPDTYYGVTKVFGEAMGHYYANRHGLDVVNLRIGWLLSEDELEDE
VSDRDGAGERYARAMWLSPDDCQQVIRAAATTTLESTPLTAHGISDNSERFLSLSETMLE
LGYRPRDDSADVLGGQ
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaccgagatcgccatcacgggcgcatcggggcgggtcggcaggcagtccatcgaggcg
ttcgacgacgagacgctcacgctcttctcccacagcgagagcgaggatttagacaccgag
accctcgagatcgcgaaccgcgacgagttcgtcgaggccctcgagggccaggacgtcctg
atccatctggcggcgaatccgagcccgcgagccgagtgggacgaggtccgtgaaccgaac
gtcgacggcgtctacaacgcgttccacgccgctgtggagaacgacctcgagcgggtggtc
ttcgcgagttcgaaccacgcggtcaacatgtccaacgtcgtctcgcccatccgtccggag
tcgacggtcggcaagcccgacatcgtccggccggacgacgagatggatcccgacacctac
tacggcgtcaccaaggtcttcggcgaggcgatgggccattactacgccaaccgccacggg
ctggacgtggtcaacctgcggatcggctggctgctctcggaggacgaactcgaggacgaa
gtctcagaccgcgacggcgccggcgagcgatacgcccgcgcgatgtggctcagtcccgac
gactgccaacaggtgattcgcgcggccgcgacgacgaccctcgagtcgacgccgctgacc
gcccacggcatctccgacaactcggagcggttcctctccctgtcggagacgatgctcgaa
ctggggtatcggccccgagacgactcggccgacgtgttgggtggccagtag

DBGET integrated database retrieval system