KEGG   Haloferax volcanii: HVO_0511
Entry
HVO_0511          CDS       T01200                                 

Gene name
azf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase (NAD)
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
hvo  Haloferax volcanii
Pathway
hvo00030  Pentose phosphate pathway
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HVO_0511 (azf)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     HVO_0511 (azf)
SSDB
Motif
Pfam: Epimerase 3Beta_HSD Polysacc_synt_2 GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 NmrA RmlD_sub_bind
Other DBs
NCBI-ProteinID: ADE03728
UniProt: D4GS48
LinkDB
Position
448281..449069
AA seq 262 aa
MDQPVLLTGAGGRVGQAILGHIGDAYDWRLLDREPLSDEKIPDSVDSTEVYVADVTDETA
VRNAMDGVHAVIHLAGDPRPEAPWDSVLRNNIDGTQQMFDAAVDVGVEKFAFASSNHAVG
AYETTDRTPDMYRPHHEFRLDGTELPRPSNLYGVSKAAGETLGRYYHDHHDISVVNVRIG
NLTQHHPPKEYERGQAMWLSYRDCGHLFECCIEADYDYEIVYGISDNDRKYYSIDRARAV
LGYDPQDNSAEFTFEGEPLDEA
NT seq 789 nt   +upstreamnt  +downstreamnt
atggaccagccggttttgctgacgggggctggcgggcgcgtcggccaggcgatactaggg
cacatcggcgacgcctacgactggcggctgttggaccgcgagccactctccgacgagaag
attcccgattcggtcgactccacggaggtgtacgtcgccgacgtcaccgacgagaccgcc
gtgcgaaacgccatggacggcgtccacgccgtcatccacctcgcgggcgacccgcgtccc
gaagcgccgtgggacagcgtcctgcggaacaacatcgacggcacccaacagatgttcgac
gccgcggtcgacgtcggcgtcgagaagttcgcgttcgcctcctcgaaccacgccgtcggg
gcgtacgaaacgacggaccggacgcccgatatgtaccgcccgcaccacgagttccgactc
gacgggacggaactaccgcgcccgagtaacctctacggcgtgagcaaggccgccggcgag
acgctcggccgctactaccacgaccaccacgacatctcggtcgtgaacgtccgcatcggc
aacctcactcagcaccacccgccgaaggagtacgaacgcgggcaggcgatgtggctgtcg
taccgcgattgcgggcatctcttcgagtgctgtatcgaggccgactacgactacgaaatc
gtctacggtatctccgacaacgaccgtaagtactactccatcgaccgcgctcgggcggtg
ctcggctacgacccgcaggacaactccgccgagttcaccttcgagggcgaaccgctggac
gaagcgtag

DBGET integrated database retrieval system