KEGG   Haloferax volcanii: HVO_0511Help
Entry
HVO_0511          CDS       T01200                                 

Gene name
azf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase (NAD)
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
hvo  Haloferax volcanii
Pathway
hvo00030  Pentose phosphate pathway
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HVO_0511 (azf)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     HVO_0511 (azf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD Polysacc_synt_2 NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ADE03728
UniProt: D4GS48
LinkDB All DBs
Position
448281..449069
Genome map
AA seq 262 aa AA seqDB search
MDQPVLLTGAGGRVGQAILGHIGDAYDWRLLDREPLSDEKIPDSVDSTEVYVADVTDETA
VRNAMDGVHAVIHLAGDPRPEAPWDSVLRNNIDGTQQMFDAAVDVGVEKFAFASSNHAVG
AYETTDRTPDMYRPHHEFRLDGTELPRPSNLYGVSKAAGETLGRYYHDHHDISVVNVRIG
NLTQHHPPKEYERGQAMWLSYRDCGHLFECCIEADYDYEIVYGISDNDRKYYSIDRARAV
LGYDPQDNSAEFTFEGEPLDEA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccggttttgctgacgggggctggcgggcgcgtcggccaggcgatactaggg
cacatcggcgacgcctacgactggcggctgttggaccgcgagccactctccgacgagaag
attcccgattcggtcgactccacggaggtgtacgtcgccgacgtcaccgacgagaccgcc
gtgcgaaacgccatggacggcgtccacgccgtcatccacctcgcgggcgacccgcgtccc
gaagcgccgtgggacagcgtcctgcggaacaacatcgacggcacccaacagatgttcgac
gccgcggtcgacgtcggcgtcgagaagttcgcgttcgcctcctcgaaccacgccgtcggg
gcgtacgaaacgacggaccggacgcccgatatgtaccgcccgcaccacgagttccgactc
gacgggacggaactaccgcgcccgagtaacctctacggcgtgagcaaggccgccggcgag
acgctcggccgctactaccacgaccaccacgacatctcggtcgtgaacgtccgcatcggc
aacctcactcagcaccacccgccgaaggagtacgaacgcgggcaggcgatgtggctgtcg
taccgcgattgcgggcatctcttcgagtgctgtatcgaggccgactacgactacgaaatc
gtctacggtatctccgacaacgaccgtaagtactactccatcgaccgcgctcgggcggtg
ctcggctacgacccgcaggacaactccgccgagttcaccttcgagggcgaaccgctggac
gaagcgtag

DBGET integrated database retrieval system