KEGG   Haloferax volcanii: HVO_B0200
Entry
HVO_B0200         CDS       T01200                                 

Symbol
aceB2
Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
hvo  Haloferax volcanii
Pathway
hvo00630  Glyoxylate and dicarboxylate metabolism
hvo01100  Metabolic pathways
hvo01120  Microbial metabolism in diverse environments
hvo01200  Carbon metabolism
Module
hvo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HVO_B0200 (aceB2)
Enzymes [BR:hvo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     HVO_B0200 (aceB2)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     HVO_B0200 (aceB2)
SSDB
Motif
Pfam: HpcH_HpaI Marek_A
Other DBs
NCBI-ProteinID: ADE01480
UniProt: D4GPK1
LinkDB
Position
pHV3:231494..232804
AA seq 436 aa
MSSDRNYEREFVRTFFTSPTAVSGENSAKMLQSAAQLRGMQAPDTWIPDNEDATAPSMRA
EGVQNLVEVVSEHGADFPGEIHPRVVWHRDDPSTRYEGFKQMLEITDPENGAVEHIDGFV
IPEVGDLDDWKKADEFITIIEHEHGLDEGSLSMSVIIESGEAELAMSDLRAEKGKPSNNL
ERLFLLVDGQVDYTKDMRAMTPTGELPAWAELRHNTSRGASAAGCIAVDGPYDDIRDVEG
YRERMVENRAMGMTGIWALTPGQVVTANEAPLPPKTGSWLLELDDDEIELDAEDGRQVYD
GDELSLEQVGDDSYVLRVDGEEQELDAEELHEELLDLTTYVPSMDDIVDSMEEFEAAKEA
GKGAIAMTQATTLVIDGVEVDIAKDRMWDEATYQAAMTPVALFQDVYEHRPDQHDALEEM
YGEGIVERAMAVGTDD
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagtagcgacagaaactacgaacgagagttcgtacggacgttcttcacctcgccgacg
gcggtcagcggcgagaactcggcgaagatgttgcagagcgcggcccaacttcgggggatg
caggcccccgacacatggattccggacaacgaggacgccacggcaccgtcgatgcgggcc
gagggcgtccagaacctcgtcgaggtcgtctccgaacacggagccgacttccccggcgag
attcacccccgcgtcgtgtggcaccgcgacgacccctcgacccgctacgagggcttcaag
cagatgctcgaaatcaccgaccccgaaaacggtgcggtcgagcacatcgacgggttcgtc
atccccgaggtcggtgacctcgacgactggaagaaggccgacgagttcatcaccatcatc
gagcacgaacacggtctcgacgagggaagcctctcgatgtcggtcatcatcgagagcggc
gaggccgaactcgcgatgagcgacctccgcgcggagaagggcaagccgtccaacaacctc
gaacggctgttcctcctcgtcgacgggcaggtcgactacacgaaggacatgcgtgcgatg
acgccgaccggcgagcttccggcgtgggccgaactgcggcacaacacctcccgcggggcc
agcgccgccggctgtatcgccgtggacggcccctacgacgacatccgcgacgtggagggc
taccgcgaacgcatggtcgagaaccgcgccatggggatgacgggtatctgggcgctcacg
cccgggcaggtcgtcaccgcaaacgaggcaccgctgccgccgaagaccggcagttggctc
ctcgaactcgacgacgacgaaatcgaactcgacgccgaggacggtcgacaggtgtacgac
ggcgacgaactctcgctcgaacaggtcggcgacgacagctacgtgctccgcgtcgacggc
gaagaacaggaactcgacgccgaggaactccacgaggagctgctcgacctcaccacctac
gtcccgagcatggacgacatcgtcgactccatggaggagttcgaggcggccaaggaggcc
ggcaagggcgcgattgcgatgacgcaggcgacgacgctcgtcatcgacggcgtcgaagtc
gacatcgccaaggaccgcatgtgggacgaggcgacctatcaggccgcgatgacgcccgtc
gccctgttccaagacgtgtacgagcaccgcccggaccaacacgacgccctcgaggagatg
tacggcgagggcatcgtcgagcgcgcgatggccgtcgggacggacgactaa

DBGET integrated database retrieval system