KEGG   Haloquadratum walsbyi C23: Hqrw_1842
Entry
Hqrw_1842         CDS       T01942                                 

Symbol
aceB
Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
hwc00630  Glyoxylate and dicarboxylate metabolism
hwc01100  Metabolic pathways
hwc01120  Microbial metabolism in diverse environments
hwc01200  Carbon metabolism
Module
hwc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hwc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hqrw_1842 (aceB)
Enzymes [BR:hwc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     Hqrw_1842 (aceB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Hqrw_1842 (aceB)
SSDB
Motif
Pfam: HpcH_HpaI Ntox5
Other DBs
NCBI-ProteinID: CCC39767
UniProt: G0LI47
LinkDB
Position
898645..899952
AA seq 435 aa
MSVERHYDREFVRTFFTSPTAVEGEDDSAKMIQSAAQLRGLKAPDVWVPDNEDATAPSMR
DEGVENIISVVAEHGAEFPGEIHPRMVWHRERPTTRYQGFQHMLQIANPDNGAVEHIDGF
VIPEVGDIDDWKKADEFFTIVENEYGLEEGSLSMSVIVESGEAELALGDLRAEMGKPSNN
LERLFLLVDGEVDYSKDMRGMTPTGELPSWPELRHNTSRGASAAGLIAVDGPFDDIRDIE
GYRERMIDNRAKGMIGIWSLTPSQVVEANTEPLPPQTGSWLLTAGDTDIELEQTNGKHIY
DGDSVSLSVEDDDTHHLVVGSDEHTLDRDELRSELLKMTAYVPSMDDIVDSMEEFEAAKE
AGKGAIAMTQSATLVIDGVEIDIETDRMWDEATYQAAMTPIALFQDVYEHRTDQHDELED
RYGADVVNRATQVGN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgagtgttgaacgacactacgatcgtgagtttgttcggacattctttacatctccaaca
gctgttgaaggcgaagatgactccgcaaagatgattcaaagtgcagcacagcttcgaggg
ctgaaagcacctgatgtctgggtgccagataatgaagacgcgactgctccctcaatgcgc
gatgaaggggttgaaaatatcatttcagtcgttgctgagcacggcgcggagttccctggt
gagattcaccctcgaatggtctggcatcgtgaacgaccaacaactcgatatcagggattc
cagcatatgctacagattgccaatcccgataatggagcggtcgaacatattgatggattt
gtgattccggaagtcggcgatattgatgattggaaaaaagccgatgagttctttacgatt
gtcgaaaatgaatatgggcttgaagaagggagcctttcaatgtcagtgattgttgagagc
ggtgaagctgagttagcacttggagacctccgtgcagagatggggaagccatcaaacaat
cttgagcggcttttcttattagtcgacggagaagttgattacagcaaagacatgcgcgga
atgacaccaaccggcgaacttccatcatggccagaactgagacacaacacctctcgtggc
gcaagcgctgctgggcttattgctgttgatggtccatttgatgatatccgcgatatcgag
gggtatcgtgaacgaatgatagataatcgtgcaaaaggaatgattggtatctggtcactc
acaccgagccaggtcgttgaggcaaacactgagcctcttccgccacaaaccggttcgtgg
cttcttactgctggtgatactgatatagagctcgagcagacgaacggcaaacacatctat
gatggtgacagcgttagtctctctgtcgaagatgatgacacacaccatcttgtcgtcggg
agcgatgagcacaccctggaccgggatgaacttcgatcagagctgcttaaaatgacagca
tatgtcccgagtatggacgatattgttgattcaatggaagaatttgaggccgcaaaagag
gctggaaagggcgcaattgcaatgacgcaatctgcgacactcgtgattgacggtgttgaa
atcgatatcgagactgatcgaatgtgggatgaggcaacatatcaagcggcaatgacacct
attgcactcttccaagacgtctatgaacaccgtactgaccaacatgatgaacttgaggat
cgatacggtgccgatgttgtcaaccgagcgacacaagttggaaattaa

DBGET integrated database retrieval system