KEGG   Iocasia fonsfrigidae: GM661_06785
Entry
GM661_06785       CDS       T07718                                 
Name
(GenBank) CMP-N-acetlyneuraminic acid synthetase
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
ifn  Iocasia fonsfrigidae
Pathway
ifn00541  O-Antigen nucleotide sugar biosynthesis
ifn01100  Metabolic pathways
ifn01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:ifn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    GM661_06785
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3
Other DBs
NCBI-ProteinID: QTL97711
UniProt: A0A8A7K8C5
LinkDB
Position
1424082..1424774
AA seq 230 aa
MSKILALIPARAGSKGVKSKNIRELAGKPLIAYTIMEAIKSNIFEDIIVSTDSEKIADIA
RKYGANVPFLRPKKFALDDSSTIDVIIHCFNFMRNIGKEYQEVILLQPTSPLRRAHHIKE
AYQLFNSKNADFIISVCKCGHPPLWANTMDKDLKMDNFIRKEVKNMRRQDLPQFYQINGA
LYLAKVDKLIEEKGFLGKNSYAYIMSRENSIDIDTEIDFRFCEVIMGAVV
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagtaaaatcctagcacttatacctgcgagagcgggttctaagggagtaaaaagtaaa
aacattagagaattagctggaaaaccacttatagcatatactattatggaagctattaag
agtaatatatttgaagatattattgtatctactgactcagaaaaaatagcagatatagca
agaaaatatggtgcaaatgtgcctttcttaagacccaaaaaattcgctttagatgattcg
tctacaattgatgtaattatacactgttttaattttatgagaaatatagggaaagaatat
caggaagttatattacttcaaccaacatctccattaagaagggctcatcatataaaagaa
gcttatcagctttttaatagtaaaaatgctgattttattataagtgtatgcaagtgtgga
catccaccactttgggctaatacaatggataaggatttaaaaatggataatttcattcga
aaagaagtaaaaaatatgaggagacaagatttaccccaattttatcaaataaatggtgct
ttatatttagcaaaagtcgataaactgattgaagaaaaaggttttttaggtaaaaatagc
tatgcttatataatgagtagggaaaattcaatagacatagataccgaaatagattttaga
ttttgtgaagttattatgggagcagttgtgtag

DBGET integrated database retrieval system