KEGG   Iocasia fonsfrigidae: GM661_14600
Entry
GM661_14600       CDS       T07718                                 
Name
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K21585  3-aminobutanoyl-CoA transaminase [EC:2.6.1.111]
Organism
ifn  Iocasia fonsfrigidae
Brite
KEGG Orthology (KO) [BR:ifn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GM661_14600
Enzymes [BR:ifn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.111  3-aminobutanoyl-CoA transaminase
     GM661_14600
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: QTL99100
UniProt: A0A8A7KCW7
LinkDB
Position
complement(3037835..3039088)
AA seq 417 aa
MSEVGKLNLEKSMSEVARGYELTPGAVLGIRRPYNFVEGEYPNYFESGKGSRIIDLDGNE
YIDYLCAYGPIIMGYCEEEIDEAVIKQIRDKGFCFSLTQSIQNRLAEKMVEIIPSAEQVI
FLKTGSAAATLAVRLARGYTDKTKIMRCGYHGWHDWCVEVKGGIPEKLYEDVYSFKYNDL
ASLEELLFEHGNDTAAIIITPVGHPLGNKIEEPKPGFLEGVRELADKYNTILIFDEIRTG
FRVALGGAQEYYGVTPDLSLFGKAMANGYAIAAVAGKKEVMKKAEHDVFVSSTFFPNSLS
FAAALKTIELLQSKKVLEYIWEKGSKFLEDIKALTAKYPVGAEVSGIPPMPYITFQRDKA
KTYKEKRTDFYTQLIRRRVFMQPYHHGYICYRHTDEDLNYTVKAIEESLVYIEEKDY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgagtgaagtaggaaaattaaatttagaaaaaagcatgagtgaggtagccaggggttat
gagctgacacctggtgcggtgcttgggatcagaagaccttataattttgtagagggtgaa
tacccaaattactttgaatctggtaaaggatccaggattattgacctggatggtaatgaa
tatattgattatctatgtgcttatggtccaattattatgggctactgtgaggaagaaata
gatgaggctgttataaaacagattagagataagggtttctgtttttctttaactcaatct
attcaaaataggttggcagaaaaaatggttgaaataataccatctgctgaacaggttatc
tttctaaaaacaggttctgctgctgccaccctggctgttagactggcccgcggttatacc
gataagaccaagattatgcgctgtggttatcacggctggcacgactggtgtgttgaggta
aagggtggtataccagaaaaactctatgaagatgtttacagttttaaatataatgacctt
gctagtctggaagagttattgttcgagcatggtaatgatactgctgctatcatcataaca
ccggttggccatccactgggtaataagattgaagaaccaaaacctggtttcttagaaggt
gttagagaactggctgataagtataatactatcttgatttttgatgagattaggactggt
ttccgggtagcactgggtggtgcccaggaatattatggagtgacaccagatctgtcactc
tttggcaaggcgatggcaaatggctatgctattgctgcagtagctggcaaaaaagaggta
atgaaaaaggcagaacatgatgtgtttgtttcttcgaccttttttcccaacagtctttct
tttgccgcggctttaaagactattgagttattacagtccaaaaaggtactagaatatatc
tgggaaaaaggcagtaaattcttagaagatattaaagccttgactgcgaaatatccggtt
ggggcagaggtatctggcataccccctatgccctatataaccttccagagggataaagct
aaaacctataaagaaaagagaactgatttctatacacagttgatcaggcgtcgtgtcttt
atgcagccatatcaccacggctatatctgctatcgtcatactgatgaagaccttaattat
acagttaaggctattgaagagagcttggtctatattgaagaaaaagattattaa

DBGET integrated database retrieval system