Intestinibacillus sp. NTUH-41-i26: RX717_09335 Help Entry RX717_09335       CDS       T09461                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism int  Intestinibacillus sp. NTUH-41-i26 Pathway int00190   Oxidative phosphorylation int01100   Metabolic pathways Module int_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:int00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RX717_09335 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:int00194]     RX717_09335 (atpE) Photosynthesis proteins [BR:int00194]  Photosystem and electron transport system   F-type ATPase [OT]    RX717_09335 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WOC74229 LinkDB All DBs Position complement(1825603..1825866) Genome browser AA seq 87 aa AA seqDB search MGIDSNAFVAGMSALGAGMAMIAGLGPGIGEGYTAGQACAAIGRQPEAQGDITRTMILGI AMAESTGIYALVIALILLFANPFVGNF NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgggtatcgattctaacgcatttgtagcaggtatgtccgccctcggcgccggtatggcg atgatcgcgggccttggccctggcatcggcgaagggtacaccgcgggccaggcgtgtgcg gcgatcggccgccagccggaggcgcagggcgatattacccgtaccatgattcttggtatc gccatggcggagtctaccggtatttacgcgctggttatcgcgctgatcctgctgtttgcc aacccgtttgtcggcaatttctga

DBGET integrated database retrieval system