KEGG   Kazachstania africana: KAFR_0G02090
Entry
KAFR_0G02090      CDS       T02487                                 
Symbol
KAFR0G02090
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
kaf  Kazachstania africana
Pathway
kaf04111  Cell cycle - yeast
kaf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KAFR_0G02090 (KAFR0G02090)
   04113 Meiosis - yeast
    KAFR_0G02090 (KAFR0G02090)
SSDB
Motif
Pfam: Fungal_TACC Filament UPF0147 DUF1664 BRE1 CENP-F_leu_zip DUF724 DUF4201
Other DBs
NCBI-GeneID: 13887223
NCBI-ProteinID: XP_003958378
UniProt: H2AXZ3
LinkDB
Position
7:complement(437389..439587)
AA seq 732 aa
MDYDQVPVTPLKQTIGQKTDANVRKSGENELPILSNSKEQHNLTPSNITNVLDEISSSDN
VTPISHLKVYPHSLSAKKRNAATCDSNNSNLSLDFGRNNEERGTASNTLEQLDINQMFNS
NVQLNHSPLKIDLSSPNKDSNDNNSNTHIDKKIKLSDVPDLKQEDVNIFDDERSSPVPIS
MIEGVSPLKNDNLDELFSHKLTPVKPSADNGEDENYDFNKVIELVNKRNNELNKEVYDKN
SKINEISLNFDRLNNEYVNQKKEIDNLMTEKNEIVTKLNEMQVVNNELVSKNEKLKVKVT
EFKNEINTLNANQSLLKSKYDNLISENDALKKNKELLNNLSIENEKLINQGKNWETRFSE
LENEKDSADEKFAQIKEQFSELTSRNESLENQITELNELLSVAKEENKNSDLLNEVNSLQ
EERKELQKKLEKIELDKENEVSILESKISALNETISSLQSCQKEIENLNSTKTNLENDLT
ALKSKFEEVNDNSSIRTAEVTELNSQIESLRESNDQLQELNSKLDEEIEILKSESLKQDE
EYKKVSIELESIQLKNKNVEVERNDELESLHKTVDSLEKSLKGGYDEITQLKKVNEQLKS
QLESFEQNTHEDHSAVETLKKDFELKDKDSQEQIKALESQITSWRQKMEHNERDITQRLK
NLADDLYVKYSSKHEQKVKLLKKSYESKYQSEIERLSLENKGFNQEIEQLNKQIENERRE
KQELLKILETKE
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggattacgatcaggtaccagtgacgccactgaaacaaactataggccaaaagactgat
gccaatgtcaggaagagcggggagaatgagcttccgatattgtcgaattcaaaggagcaa
cacaaccttacaccttctaatataacgaacgttttggatgaaattagcagctcagacaat
gttacaccgatttcccatttgaaagtataccctcacagcctttctgctaaaaagagaaat
gccgctacgtgtgattcaaataattcaaatctatctttagattttggaagaaataatgaa
gaaagaggcactgcttcgaatacactggaacagttagatattaatcaaatgttcaatagt
aacgtacagctaaatcattcgccgctgaaaatcgatttaagctcgccaaataaagatagt
aatgacaacaacagtaatacccatattgataaaaagataaagttgagtgatgttccagat
ttgaaacaagaagatgtcaatatatttgatgatgaaaggagttcacctgttccaatcagt
atgatcgaaggtgtatcgcctttgaaaaatgataatcttgacgaattattcagtcataag
ttgactccagtaaaaccttctgcggataatggggaggatgaaaattatgatttcaataaa
gtaatagaattagttaataagagaaataatgaattaaacaaggaagtttatgataaaaat
tccaaaataaatgaaatttcactaaattttgatcggttgaacaacgaatacgttaatcaa
aagaaagaaattgacaacttaatgactgaaaaaaacgaaatagttacaaaattgaatgaa
atgcaagtagtgaataatgaactagtcagtaaaaatgaaaaactaaaagtgaaagtgacc
gaatttaaaaatgaaattaacacattgaatgcaaaccaatcattactgaaatctaaatac
gacaatttaataagtgaaaatgatgctttgaagaaaaataaagaattgcttaacaattta
tctatcgaaaatgaaaaacttatcaatcaagggaaaaactgggaaacaaggttttccgaa
ttggaaaatgaaaaggattccgcagatgagaaattcgctcaaataaaggaacaattcagt
gaactcacctctagaaatgaatcattggaaaatcaaataactgaattgaatgagttacta
agtgtagctaaagaagaaaataagaatagtgacttgttaaatgaagtcaacagcttacaa
gaagaacgaaaagaattacagaaaaaattagagaaaattgaactcgataaagaaaatgaa
gtttcaattctagaatctaaaatatcagcattaaacgaaactatttcatcattacaaagt
tgtcaaaaggaaatagaaaatttaaatagtacaaaaaccaacttagaaaatgatttaacc
gccttaaagagcaaatttgaagaagttaatgataactccagcattcggacggcagaggtt
acagagctaaattcccaaattgaatccctgagagaatccaatgaccaattacaggaacta
aatagcaagttagatgaagaaatcgaaattttgaaatctgaaagtttgaagcaagatgaa
gagtataaaaaggtatcaatagagttagaaagtattcaactcaagaataaaaatgttgaa
gttgagagaaatgatgagttagaatccttacataaaacggtcgattcgctagagaaatct
ttaaagggcggttacgatgaaataactcaattgaaaaaagtaaatgaacaattgaaatca
caattagaaagctttgaacaaaatacccatgaagatcattcggcggttgagactttaaag
aaagattttgagttgaaagataaagacagtcaagaacaaattaaggcacttgaaagtcag
ataacaagctggagacaaaagatggaacacaacgaacgagatataactcaaaggttgaag
aacctagcagatgacctttacgttaaatactcttcaaaacatgaacagaaggtcaaacta
ctgaaaaaaagttatgaatcaaagtatcagtctgaaattgaaaggctgtcgttagaaaat
aagggcttcaaccaagaaattgagcaattgaataagcaaattgaaaacgaaagaagggaa
aaacaagaactattaaaaatattagaaactaaagagtag

DBGET integrated database retrieval system