KEGG   Kazachstania africana: KAFR_0I02750
Entry
KAFR_0I02750      CDS       T02487                                 
Symbol
KAFR0I02750
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
kaf  Kazachstania africana
Pathway
kaf04111  Cell cycle - yeast
kaf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KAFR_0I02750 (KAFR0I02750)
   04113 Meiosis - yeast
    KAFR_0I02750 (KAFR0I02750)
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 13883689
NCBI-ProteinID: XP_003959189
UniProt: H2B0A4
LinkDB
Position
9:556570..558231
AA seq 553 aa
MSRLPVIDLDAVSSEDDILPVLKAILVNYDTFLLKNYANTLDTGSLGEIDLEQGFDANFT
GTVQIEEHTYLEQYIATTDTSLQFDRACTDQGLNKISAKLLKLAIFFGQLALNAMDGTND
IDLEKHYSTKLTRYYSAQAGNMTLFDGESIEYLSPKNYTTHVSTGILTIFPQACGIRYKP
ITTSNDDNVWTVVDEPDCLLFHTGTYLQTISHGLHSTSPIQIDINRHNILHLTVYPEMGL
QVGAEETIASLLLKQQIVELPSVGGTYYQDELSRLNLKKKIKFYGKLFATVETIVSLNYI
SKPRDMAMEVDKILVQCTNLMQNKITEDDFLKMLSIWPGVYNVEVNFNGELTVRLPFSNN
LLKLTNNSRKLQYVQLIEAWYEKQLQRRHGAPAEDLDPVKFQKRHYHRDGLVKANKTTTR
RTYISNSKDKFIFQEKRDDSQVNLLNRIKAKERTAMEELQLRESQYDKFLKVKMQKIMSI
LQTLVENEPYTMTYLNSLVVDSLRDGNNPISEEESEQCLLKIQQWLGEDTMRLITVKNGL
KVLKWRGLNGVTL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgagtaggttgccagtgatagatttggatgctgtatcttccgaggatgacattttgcct
gttttgaaggctattttggtgaattacgatactttcctgctgaagaactatgccaacacg
ttagatactgggtctttgggtgagatcgatttggaacaaggcttcgatgcgaatttcacc
gggacagtgcagattgaagagcatacgtatctggaacagtacattgctactacggacacg
agtctgcaattcgacagagcatgcactgatcagggtttgaacaagatttctgccaaattg
ctgaaattggccattttttttggtcaattggcattgaatgccatggatgggaccaacgat
atcgatttggagaagcattattctacgaaattgactcgttactattctgcacaggctggt
aacatgacgttgtttgacggtgaatccatcgagtacctctcaccaaagaattatacgaca
cacgtaagcacaggtatcttaacgattttcccacaggcatgcggaatcagatacaaacct
atcacgacgtccaatgacgataatgtatggaccgtagtggatgaaccggattgtcttttg
ttccatacgggcacatatttacagactatttctcatgggttgcattcgacatcaccgatt
caaattgacatcaatagacataacatcttgcatttgactgtgtaccctgaaatgggactc
caagtaggggccgaagagaccattgcttcgttactattgaaacaacagatagtggaatta
ccgagtgttggtggcacgtattaccaggatgaactatcgagattgaacttgaagaaaaag
ataaaattttatgggaaattgttcgccactgtggagactattgtgtcgttgaattacata
agtaagcctcgtgatatggccatggaggtggacaagatcttggtccaatgtacgaatttg
atgcaaaataagatcacagaggatgattttctgaaaatgctatcgatatggccaggtgtt
tacaacgtggaggtgaattttaatggagaattgactgttagattacctttctccaataat
cttctgaaattgacgaacaattcaagaaagttacagtacgttcaactgatcgaagcatgg
tatgaaaaacagttgcaaaggcgtcatggtgcaccagcggaagatcttgaccctgtaaag
tttcaaaagagacattaccatcgtgatggactggtcaaagccaacaagacgaccacaagg
agaacgtacatttccaactcaaaagacaaattcattttccaagagaaaagagatgattca
caagtaaatctactgaacagaatcaaagcaaaagagagaactgccatggaggaactacaa
ttgagagaatcccaatacgataaatttttaaaagtcaagatgcaaaagataatgagtata
ttacaaactcttgtcgagaatgagccgtacacaatgacgtatctcaattccctggtggta
gattcattgagagatggtaataacccaataagtgaagaagaatctgagcaatgtctcttg
aagatccagcaatggctaggtgaggacacgatgagattgatcactgtgaagaacgggttg
aaagttttaaaatggcggggattaaatggtgtgacgttatga

DBGET integrated database retrieval system