KEGG   Kazachstania africana: KAFR_0K00390
Entry
KAFR_0K00390      CDS       T02487                                 
Symbol
KAFR0K00390
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
kaf  Kazachstania africana
Pathway
kaf04111  Cell cycle - yeast
kaf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KAFR_0K00390 (KAFR0K00390)
   04113 Meiosis - yeast
    KAFR_0K00390 (KAFR0K00390)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kaf03400]
    KAFR_0K00390 (KAFR0K00390)
DNA repair and recombination proteins [BR:kaf03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    KAFR_0K00390 (KAFR0K00390)
SSDB
Motif
Pfam: Rad9 DNA_pol_B_3 SelO
Other DBs
NCBI-GeneID: 13886583
NCBI-ProteinID: XP_003959529
UniProt: H2B194
LinkDB
Position
11:85188..86960
AA seq 590 aa
MSFRAVISNADKHNVWYRTVYMLSTINENIKMTITSSELIIWAMNSTDTTLSQIRFSKTF
FDEYEFRPYEITFGEEGLQVTADLRGNDYKLYSIEIKGKHLTTISRKPDGDTVTKFIISI
NNGATCSEALINRLLVTVEMESLIKKEYSPQFAPIRYDPIVIDLKYKRKFLDVFGTSAET
TNPEEILDPKLIAVFNDLEQELSLALFNDNVRSELRQHSQLSIEDEINYICCNQTLLKNF
IENCNPNITETIKLEINTRKMIITAFMKKINGKDDVILKNALSMSNTISTVDLEHYCIFT
VENEAPEGRSGAGRSKEGRKYVDFRLRDFRNFMNLLSSWKLQGNGGVNNINIWFCHPGDP
ILIEMSRAGVKMQLVQVTEASMVSSKNSMEGAIKKNTSPNPVRPASGNGNMQATNMSPLK
SDMENHQDTRVNSRISPLKNVAPPIPVLRSNMPVELPVVRKLFVSENSQEDHEANNVPYT
SIAGSIPSNAHEEPNDDNQHDAVDEQDFAIAGRHETTIGWGKRNSSEAFNDASDRVSEAD
RQMVLRREKAKYLRISDSGDGNEGSHDNDGNEAAQGLGPTQPFKPKGLFD
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgtccttcagggctgtgataagtaatgcagataaacacaatgtatggtataggactgtc
tatatgctatcgaccattaatgaaaatatcaaaatgactataacttcttcagagttgatc
atttgggcaatgaacagtacggatacaacactgtctcaaatacggttctccaaaactttt
tttgatgaatatgaattcagaccatacgagattacatttggagaagagggattgcaggta
acggccgatttaagaggtaacgattataaattatattctattgagattaaagggaagcat
ttaactacgatttcaagaaaaccggatggagatactgtcactaagtttattatttcaata
aataacggcgctacttgttcagaagctcttattaatagattattagtgaccgtggaaatg
gaatccttaattaagaaagaatattccccacagtttgcgcccataaggtatgatcccata
gtaattgatttaaaatataagcgtaaatttttagatgtatttggtactagtgctgaaacc
accaatccagaagaaattttggatcctaaactcattgctgttttcaatgatttggaacaa
gaactttccttggctttatttaatgataatgttcggtcagaacttagacaacacagccag
ctcagtatcgaagatgaaattaattatatttgttgtaatcagacccttttaaagaacttt
attgaaaactgtaatccaaatattaccgaaactataaagctggagataaatacacgaaag
atgatcataactgccttcatgaagaagataaatggaaaagatgatgtgattttaaaaaat
gccttgagtatgagtaatactataagtaccgtagatttagagcattactgtatttttact
gtagaaaacgaagcacctgagggaagaagcggcgcaggtagatccaaagaaggcagaaaa
tatgtcgatttcaggctgagagatttcaggaattttatgaaccttctgtcttcgtggaag
ctacaaggcaatggtggtgttaataacataaatatttggttttgtcacccaggtgatcca
atattaatcgaaatgtctagagccggtgtcaaaatgcaacttgttcaagtaactgaggct
agtatggtatctagcaagaacagtatggaaggtgcaataaagaagaatacatcaccaaac
cctgttcgtccagcgagtggaaatgggaacatgcaagctacaaatatgagccctctgaaa
tcagacatggaaaatcaccaagatacaagagtaaatagtcgtatcagtccattgaaaaac
gtagccccacctattccagtgctgcgtagtaacatgccagtagaattgcctgttgttaga
aaattattcgtttcagagaattcccaggaagatcacgaggcaaacaatgttccgtatacc
tctattgccggcagtataccatcgaatgcacatgaggagcctaatgacgataaccaacac
gatgctgttgatgagcaagacttcgctattgctggaagacatgagaccacaatagggtgg
gggaagcgtaacagcagtgaagcctttaatgatgccagcgacagagtttctgaagctgat
aggcaaatggtacttagaagggagaaagcgaagtatctgagaatttcagactctggagat
ggaaatgaaggtagtcacgataatgacggtaatgaggcagcccaagggctgggaccaacg
cagcccttcaaacctaaaggtctcttcgactga

DBGET integrated database retrieval system