KEGG   Kinneretia sp. DAIF2: G8A07_12180
Entry
G8A07_12180       CDS       T06904                                 
Name
(GenBank) hypothetical protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
kia  Kinneretia sp. DAIF2
Pathway
kia00333  Prodigiosin biosynthesis
kia01100  Metabolic pathways
kia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    G8A07_12180
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QPF73605
UniProt: A0A7S9C774
LinkDB
Position
complement(2633504..2636293)
AA seq 929 aa
MTMELNLDPAPERLGSDKNAAPVWARRFADCAEPDARQLGGKGASLARLHQQGLPVPDGF
CIEAACLDEVATLQQLALDEALASGDAARWARMAEQLRAVQLPSRAIAAITLAYEALGAG
AVAVRSSACDEDGQAHSFAGQHDSFLQVQGLPELLQRLRDCWASLFNPAALAYRRQHGGA
LAGARMAVVVQRMVPAGFDTAAGVAFARDPLQPGAPRLLIEACVGLGEGLVSGRVVSDAY
LLATGDLRQVEQRILHKPAALLWSPERREAQLQPLPAAARERAVLSEAARHAVGELLQRC
TRLQGSPQDIEWALDAAGRLWLLQSRPITTLDELPDEPEGPHQGAPDAQRDARILWSRMD
IGEIFTGRMSPLGISFARYYQYRVHRECGKGIGLLDLGDPDEYMGYHRGHVYLNVAYTAY
LLSQTPPGLDQTPFLHRFTSEEVSLSDYRNPYGLRHGRNGLERLHSQLYWFGKTLGELVG
ARRRARRMIESRRREYERACAQDLGALDQAGLRDELRHALDYFRAMHIGYLPFYINAFGL
YGLLEELCGAWLPGRGLHLQNRLKGDMSNLRTVESARDLWALTQALCAHPGLRELLQRTP
AEQVHGALLALPEGRRFLTGAYADFMRDNGVRGREEMELTHPRWVDDPCYVFQMVKTYLQ
QGFGVDQRLAASGQQRGQDTEALLRELTPRRRWLLRQVMRLYCGCSRLREDTRMSMITSI
WLVRRVVVELTRRLVAQGLLHDMDEMAWLDFEQLRGYLEGELSAEQAFARPLIEARRRRQ
QAWLRAGEPALTFIGAPPTRTPQPAPPAAAGGDGLAGLGTSHGVVRGRARVIHDLSRQAA
ELQAGEIIVTTFTDASWTPIFALAGGVVTDIGSMLSHSSIVAREFGIPSVVNTRHASSRV
RTGDWLTVDGERGTVRIEPATDTKEPAPC
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgacgatggaactgaatctggacccggcgcccgagcgcctgggcagcgacaagaacgcc
gccccggtctgggcgcgccgcttcgccgactgcgccgagccggatgcgcggcagctgggc
ggcaagggcgccagcctggcgcgtctgcaccagcagggcctgccggtgcccgacggcttc
tgcatcgaggccgcctgcctggacgaggtcgcaacattgcagcagctggcgctggacgag
gcgctggccagcggcgacgcggcgcgctgggcccgcatggccgagcagctgcgcgcggtg
cagttgccgagccgggcgatcgcggcgatcacgctggcctacgaggcgctcggcgccggc
gcggtggcggtgcgctcctcggcctgcgacgaggacggccaggcccattccttcgccggc
cagcatgacagcttcctgcaggtgcagggcctgcccgagctgctgcagcggctgcgcgac
tgctgggcctcgctgttcaacccggccgcgctggcctaccggcgccagcatggcggcgcg
ctggccggcgcgcgcatggcggtggtggtgcagcgcatggtgccggccggcttcgacacc
gcggccggcgtggccttcgcgcgcgacccgctgcagccgggcgcgccgcgcctcttgatc
gaggcctgcgtgggcctgggcgagggcctggtctcgggccgcgtggtcagcgacgcctat
ctgctggcgaccggcgacctgcgccaggtcgagcagcgcatcctgcacaagcccgcggcc
ctgctgtggtcgcccgagcggcgcgaggcccagctgcagccgctgccggccgcggcgcgc
gagcgggcggtgctgtccgaggcggcgcggcatgcggtgggcgagctgctgcagcgctgc
acccgcctgcagggcagcccgcaggacatcgaatgggcgctcgatgcggccgggcggctg
tggctgctgcagagccgcccgatcaccaccctggacgagctgccggacgaacccgagggc
ccgcaccagggcgcccccgatgcgcagcgcgacgcgcgcatcctgtggtcgcgcatggac
atcggcgagatcttcaccggccgcatgagtccgctgggcatcagcttcgcgcgctactac
cagtaccgcgtgcaccgcgaatgcggcaagggcatcggcctgctggacctgggcgatccc
gacgagtacatgggctaccaccgcggccatgtctatctcaacgtggcctacaccgcctac
ctgctgtcgcagacgccgcccggcctggaccagacgcccttcctgcaccgcttcaccagc
gaggaggtgtcgctgagcgactaccgcaacccctacgggctgcgccatggccgcaacggg
ctggagcgcctgcacagccagctctactggttcggcaagaccctgggcgagctggttggc
gcgcggcgccgcgcgcgccggatgatcgaatcacgccggcgcgagtacgagcgggcctgc
gcccaggacctcggcgcgctggaccaggcgggcctgcgcgacgagctgcgccatgcgctg
gactatttccgcgcgatgcacatcggctacctgcccttctacatcaacgccttcgggctc
tacggcctgctggaagagctgtgcggcgcctggctaccgggccgcggcctgcatctgcag
aaccggctgaagggcgacatgtcgaacctgcgcaccgtcgagtcggcgcgcgacctctgg
gccctgacccaggccctgtgcgcccacccgggcctgcgcgagctgctgcagcgcacgccc
gcggaacaggtgcatggtgccctgttggccctgcccgagggccggcgcttcctgaccggc
gcctatgccgacttcatgcgcgacaacggcgtgcgcggacgcgaggagatggagctgacc
catccgcgctgggtcgacgatccctgctatgtgttccagatggtcaagacctatctgcag
cagggcttcggcgtcgaccagcggttggccgccagcggccagcagcgcggccaggacacc
gaggcgctgctgcgcgagctgacgccgcgccggcgctggctgctgcgccaggtgatgcgg
ctgtactgcggctgcagccggctgcgcgaggacacgcgcatgagcatgatcacctcgatc
tggctggtgcgccgggtggtggtcgagctgacgcggcgcctggtggcccagggcctgctg
catgacatggacgagatggcctggctggacttcgagcagctgcgcggctatctggagggc
gagctgagcgccgagcaggccttcgcccgccccttgatcgaggcacgccgacggcgccag
caggcctggctgcgcgccggcgagccggccctgaccttcatcggcgcgccgcccacccgc
acgccgcagccggcaccgcccgccgctgccggcggcgacggcctggccggcctgggcacc
tcgcatggcgtggtgcgcggccgcgcccgcgtgatccacgacctgagccgccaggcggcc
gagctgcaggccggcgagatcatcgtcaccaccttcaccgacgcctcctggacgccgatc
ttcgcgctggccggcggcgtcgtcaccgacatcggctcgatgctctcgcacagctccatc
gtcgcgcgcgagttcggcatcccctcggtcgtcaacacccgccatgccagcagccgcgtg
cgcaccggcgactggctgaccgtggacggcgagcgcggcaccgtgcggatcgagcccgcc
accgacaccaaggaacccgccccatgctga

DBGET integrated database retrieval system