KEGG   Kluyveromyces lactis: KLLA0_E19383g
Entry
KLLA0_E19383g     CDS       T01025                                 
Name
(RefSeq) uncharacterized protein
  KO
K06663  DNA damage checkpoint protein
Organism
kla  Kluyveromyces lactis
Pathway
kla04111  Cell cycle - yeast
kla04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLLA0_E19383g
   04113 Meiosis - yeast
    KLLA0_E19383g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kla03400]
    KLLA0_E19383g
DNA repair and recombination proteins [BR:kla03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    KLLA0_E19383g
SSDB
Motif
Pfam: Rad9 MBA1
Other DBs
NCBI-GeneID: 2894122
NCBI-ProteinID: XP_454828
UniProt: Q6CML1
LinkDB
Position
E:complement(1724099..1725760)
AA seq 553 aa
MSFRASINSTNEQTIWGKCLATLSQINPDVFITITENGVLISSMNATDTTMAKVRFPKSF
FTEYHFEPKKIVFGESGVQQITDCNDILHTIYSFKANAKYLSLLSLKQEDTIKEYMLTID
NCDNCSETIANKLIIKMKTASLLTKEYQVNFDPLESVQIILSLKYKQKFLSVYNNKSKGR
SLDPRLVDYFKSLQTELEHDMFNRGIANEHNIVSTVKNTPLTVNDEINFLSFDQSILRNF
IDSIMSNVIEEIKLELTRHTLAIIGFTKAVYNMKSQGYLKQAVTVTNTCSANDLEHYCIF
STEKNDGSRPSSRSQSIKKSITFKLRDFKVFLNGLNCWKTNDMIRIWFCQPGDPILFEIT
KDGVVLELVQVTDTEGRVEEPEDSVTQFNLSPEKIVSPIKKDTVVKPDKLQRPESKQMLY
PHTKRSLFITDEDGADDDDEDEEGRQFRFKRWGKQNSNTTPNSNTGSQSTPSNTTTEPSI
SEPVKRMRTTVEWGGTIESNNVGTDESHQREMNKAAYLNNLKRQAIQEDLNLQEEDDGMG
PTQADRPKGLFDS
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgtcatttcgtgcttccataaacagcacgaatgaacagaccatatggggtaaatgcttg
gcaactctttctcaaataaaccctgatgtcttcataacaatcaccgaaaatggtgtattg
atatcatccatgaatgcaacagacacgaccatggccaaggtacgatttcctaagtcgttc
tttacagagtatcacttcgagccgaagaagattgtatttggtgaatctggagtgcagcag
atcaccgattgtaatgacattcttcacacaatttatagtttcaaagcgaatgcaaagtat
ctttccctattatcacttaaacaagaggatacaattaaagaatacatgttaactatcgac
aattgtgataattgttctgaaactatagctaacaaactcataatcaaaatgaagacagca
tctttgctaactaaagaatatcaagttaattttgatccattggaaagtgttcagatcata
ttaagtctgaaatataaacaaaaattcctttcagtatacaacaacaaaagtaagggcaga
tcattagatcctcggttagtggattatttcaaatctttacaaacagaattagaacatgat
atgtttaatagaggtatcgccaatgaacacaatattgtgagcacagtgaaaaatacaccg
ttgacggttaacgacgaaatcaacttcttaagttttgatcaatcaatactaagaaacttc
attgactctattatgtctaatgtgatcgaggaaataaaattggaattgacgagacatact
ctagccataataggatttacaaaagccgtgtacaacatgaaaagtcaagggtacctcaaa
caagcagttacagtaacgaatacatgtagcgcaaatgatctagaacattactgcatattt
tcaacagaaaaaaacgacggttcgagaccttcaagcagatcacaaagtattaagaagagc
attacgttcaaattacgagatttcaaagtattcttaaatggacttaattgttggaaaaca
aatgacatgataagaatctggttttgccaacctggtgaccccattctctttgaaataaca
aaagatggggttgtattggaattagtgcaggtaactgataccgagggtagggtcgaagaa
ccagaggattctgtcacccaatttaacctgtcaccagaaaagatagtttcaccaatcaag
aaggataccgtagtgaaaccagataagcttcaaaggccggaaagtaagcagatgctgtat
ccacatacaaaacgctcactatttataacggatgaggatggagcagatgatgatgacgaa
gacgaagaaggaaggcaattcaggtttaaaaggtgggggaaacaaaatagtaacactact
cccaattcaaacactggctcccagtcaacaccatcgaacacaacaaccgagccgtcaatt
agcgagccagtaaagagaatgagaacaactgtcgaatggggaggaacaattgaatcgaac
aatgtcggtacagatgaatctcatcaaagagaaatgaacaaggctgcttatctaaataat
ttgaaaagacaagcaatccaagaagatctcaatctacaggaagaagatgatggcatgggt
cccacacaagctgacagacctaaaggtttgttcgactcttga

DBGET integrated database retrieval system