KEGG   Kluyveromyces lactis: KLLA0_E22287g
Entry
KLLA0_E22287g     CDS       T01025                                 
Name
(RefSeq) uncharacterized protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
kla  Kluyveromyces lactis
Pathway
kla04111  Cell cycle - yeast
kla04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLLA0_E22287g
   04113 Meiosis - yeast
    KLLA0_E22287g
SSDB
Motif
Pfam: CDT1 CDT1_C
Other DBs
NCBI-GeneID: 2894426
NCBI-ProteinID: XP_454959
UniProt: Q6CM80
LinkDB
Position
E:complement(1988282..1989994)
AA seq 570 aa
MDQRYRYTPPVIDLDKVKDEKELLPLIKQILFSHDTFLLQNFASIDAVVQLVDLINAETG
GFPNDDTGSVTFGSNFTGTINRGNHTLQQWMSVDGGDSRGNGSVSRDLIRLNLTMTKVAL
YFSDLCLQALGIDSNVTVSPTSFSSILCRHHSQFSEQLLDMQFDYSQTEWIDFESVGLLT
IVPDATCAKVYRNDSWHSVDVEKCLLIHTGTLLADLSAGMHQTSKMRLSTRSIALSIQPT
LSCTMPQGGSFADRLLEFNLKKFPEVGEKFYPAETRLLNLKRSVSFLNNLFATIESMINL
YKINHPGIDYVELDSLLPGISRMIKEKVTTTDFQRLLYIWPNAYEIDINSKCGISFKLQT
SLSLTKSRLLEFSEKTDQWVQLVQQSPEIPDNIPPMKLGKRKASNNSITYSVPLKNTNRR
KIAPLKGSTKSANPLYLGNKDSGNTVSGTENIATSSLLDRIRDKERRAAALLSHRQSMQE
HFIAVKMKHIFNICFTLEPEIPYTEDYLTGLVVDSLTDTHNPIGRGECVIVLSKLNELLG
QDVFQIITVEGDLKVYKWKKLDKAMIQSLL
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggatcaacgatatcgttatacacctccggttatcgatctagataaagttaaagatgaa
aaggagttacttcctctgattaaacagatcctgttctctcatgatacgtttctactgcag
aatttcgctagtatcgatgccgttgtacagctggtagatttgatcaatgcggaaactgga
ggctttccgaatgatgataccggttctgtcacatttggttctaatttcactggcaccatc
aaccgaggcaatcatactttacagcaatggatgtcagtagacggtggggacagccgtggt
aatggcagtgtgtcacgtgatttaatacggctaaatttgacgatgactaaagttgcacta
tatttcagtgacttatgcctgcaggcactcggcattgatagtaacgttacagtatcccct
acgagtttctcttccatactttgtcgtcatcattcgcaatttagtgaacaattgctcgat
atgcagtttgattactctcaaactgaatggatcgacttcgaatctgttggactattgact
atagtaccagatgcgacatgtgctaaggtttaccggaatgattcctggcacagtgtagac
gtagaaaagtgcttgttgattcatacaggtacgttattggctgatctttcggcaggtatg
catcagacttctaagatgcggttgtccacgagatcaattgcgttgtcgattcaacctacc
ctctcatgtacaatgcctcaaggaggctcttttgcagatcgtcttttggaattcaatctg
aagaaattccctgaggtgggtgaaaagttttacccagcggagactcgattacttaactta
aagcgatctgtgtcgtttttgaataatctattcgcaactatagaatcaatgattaacttg
tacaagatcaatcatccaggtatcgattacgtggaactggattctttgttaccgggtatc
tccagaatgatcaaagaaaaagtgacaacgacagatttccaaaggctattatatatctgg
cctaatgcatatgaaatagatattaactcaaaatgtgggatatcatttaaattacagact
agtttgtccttgacaaagtcaagactcttggaattttccgagaagactgatcaatgggta
caattggtccaacagtccccagaaatcccggataatattcctcccatgaaactagggaag
agaaaggcaagtaacaattccatcacatactctgtaccgttgaaaaatacaaatagacgc
aaaattgcgccattgaaagggtctacgaaatcagctaaccctctctatctgggaaacaaa
gattctggtaatacagtgtccggtacggaaaatattgcaacgagttcgctcttggataga
atcagagataaagaacggagagcagcagcgctgctctctcatagacagtcgatgcaggaa
catttcattgctgtgaaaatgaaacatatctttaacatatgcttcactctagaaccagaa
atcccatatacagaggattacttgactggcctagttgtcgattctttgacggatacgcac
aatcctatcggacgcggcgagtgtgttattgtcctttcaaaattaaatgaattacttgga
caggacgtttttcaaatcatcaccgttgaaggagatttgaaagtttacaaatggaagaaa
ttagataaagcgatgatacaatctcttttgtag

DBGET integrated database retrieval system