KEGG   Kluyveromyces lactis: KLLA0_F00770g
Entry
KLLA0_F00770g     CDS       T01025                                 
Name
(RefSeq) uncharacterized protein
  KO
K12575  kinetochore protein SLK19
Organism
kla  Kluyveromyces lactis
Pathway
kla04111  Cell cycle - yeast
kla04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLLA0_F00770g
   04113 Meiosis - yeast
    KLLA0_F00770g
SSDB
Motif
Pfam: Fungal_TACC Crescentin EzrA MAD HMMR_N Lebercilin YabA GAS
Other DBs
NCBI-GeneID: 2895832
NCBI-ProteinID: XP_455114
UniProt: Q6CLS5
LinkDB
Position
F:65967..67853
AA seq 628 aa
MDFGDKPKLEFAGSGDKLNSPIRLVPDESNKENVHALESDDQQSDKEQTYKRSKIEYSSP
EKIEMLNSLSPIKIDIEGNDGIESDLKKSVATAIEEAVQDFKKDSKAEEDEEEAFGKLNN
GFRGYHESSTANASGSAGSDAPQHAHCHESLSPIRSYGDKEMPLDPSDPTVWEKKFDDLS
SVIWDKYEEIKYLNDTVQNLRERTVEAEFNKERDKLELIKWEQKYGDVLSKLYRSEHKLE
QFDELKLQFDSVSKKFEACKQKLKEVKIELSMTNQNNHILSEKFEKEYTKFTENENLVNE
WKDKHDSLLLELNVKTKELKSITDELRSLKEQYERNENKLSEVESEIQELRKKMEEETIV
FQDTIKPRDLSITELNKKLQQFEANGSDEVSSLKSKLQITEAELDSKKNEIESLNLKLST
KETALEELRSHITQVTEDKEKSLSELEQTKRDLDSLTSRNGNIESEHLAELERLHENMSH
METNLKQNVKTIANLNETVNNFENKCKSLEAENIDLKARLTQTETNVNKSETDELRAKIQ
KLEKMVADSEAETNKKLQLLAEDLYIQYSSKHEQKVKMLKKGYEAKYQDLLDKLTVENNA
LHDEVDQLQKAVEIERAEKQELIKSLDN
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggatttcggagataaacccaagctagagtttgctggctctggtgataagcttaactct
cctataagattggttcctgatgagagcaacaaggaaaacgtacacgcattggaaagcgat
gatcaacagagcgataaggagcagacctacaagagaagtaaaatagagtactcatcccca
gaaaagattgagatgcttaatagtttatctcctataaaaatagatatcgaaggaaatgat
ggaattgagtctgatttgaaaaaatcagtcgccacagccattgaagaagcagtgcaagat
ttcaaaaaggattcaaaagcggaagaagatgaagaagaggcattcggcaagttaaataat
ggatttcgtggttatcatgaatcctccactgcaaacgcttctggatcagctggttctgat
gcaccacaacatgctcactgccatgagtcattgtcaccgataaggtcgtatggtgataaa
gagatgcctctcgacccatcagaccccacagtctgggagaagaagtttgatgatttatca
tccgtaatatgggataaatatgaagagattaagtatctcaatgatactgtacagaactta
cgagaaagaacagtagaagcggaatttaataaagagagagacaaattggaacttatcaaa
tgggagcagaaatatggcgacgtattatcaaaactgtataggagtgagcataaactcgaa
cagtttgatgaattgaaactccaatttgatagtgtcagcaaaaagttcgaagcctgcaaa
caaaaattgaaagaggtcaaaatagagttatctatgacaaatcagaacaaccacattcta
tctgagaagttcgagaaagaatataccaaattcactgagaatgaaaacttggtcaatgaa
tggaaagataaacatgattctttactattggaacttaatgtgaagaccaaggaactcaag
tcaattaccgatgagctacgctcgttaaaggaacaatatgaacgaaacgaaaacaagttg
tctgaagttgaaagtgaaatacaggagctgcgtaagaaaatggaagaagagacaattgta
ttccaagacacaattaaacctagagatctaagtataaccgagctaaacaaaaaattacag
caatttgaagcaaatggttcagatgaagttagctctttgaaaagtaagctccaaatcact
gaagcagaattagatagtaagaagaatgaaattgagtcattgaatttgaagctcagtaca
aaggaaacagcattagaagagcttaggtcacatatcactcaggtcaccgaggataaagag
aaatcattatctgagttagagcagaccaaaagggacttagactctcttacaagcagaaac
ggcaacatagaatccgaacatttagcagaactagaaagattacacgaaaatatgtcgcat
atggaaactaatctgaagcaaaacgtcaaaactatcgctaatttaaatgaaactgtcaac
aattttgagaataaatgtaaatcattggaagcagaaaatatcgatttgaaagcacgtcta
acacagacagaaaccaatgttaacaaatcagaaacggatgaactccgagctaagatccag
aaattggaaaaaatggttgcagattcagaagcagaaactaacaaaaagttgcaattatta
gctgaagatctttacatccaatactcttccaaacacgagcaaaaagtcaagatgctcaag
aaagggtacgaagccaaataccaagacctgttggacaaactaacagtcgaaaataacgca
ttgcacgacgaagtggatcaattgcaaaaagcagtggaaatagagagagcggaaaaacaa
gagctaataaagtctcttgacaactaa

DBGET integrated database retrieval system