KEGG   Kluyveromyces marxianus: KLMA_10711
Entry
KLMA_10711        CDS       T05269                                 
Symbol
TAH11
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx04111  Cell cycle - yeast
kmx04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLMA_10711 (TAH11)
   04113 Meiosis - yeast
    KLMA_10711 (TAH11)
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 34714365
NCBI-ProteinID: XP_022674222
LinkDB
Position
1:complement(1496343..1498298)
AA seq 651 aa
MVITSHMVLVLVWSWSCETPIHCGWHGMAWHSSSSHLISYCTQSLKQVSHFGESERRLNI
GIETPASKQAPPPQETMNAYKYTPPVIDLDKVGNETDLLPLMKQILLMHDSFLLQNFANI
DAVRELLGSVAQEDGPACALDASFDGVLEAGNHSLEQWVYVNDQETRPEHAESRDVRRLR
AILGRIAVYFGKLCLQALECADRDALVASGNHSAVLSRHHSKFGDQVLDLQFDYSATEWI
EFKSVGLLTVVPDATCAKVYRNDSWHGIDVENCILLHTGPVLASASRGMHSTSDLRLSTN
SLAYTVQPHLEYRMADGRYFAEHFLEFNLQRFPDIGKQAYPEEMKLVALKRSVSLLKTFF
TTMESMINLYKINHPGTDMVDLETILPSISRMMRVKVTSTDFQRLLYIWPQAYDIDINSN
CGISIKLQTTLSLTKSRLLEFAERIDQWFQNAKGSGSVPEEIPPLKLGKRKASNGSTSTT
YSSSPSKNVARRKFASLKGKPKSMSLTSSLNPTVVTPTNYGDNLTTDDVTMVDPKSSLLD
RIRVKERRAAALLSQRELMQDHFIAIKMKHVFDICFTLEPEVPYTEDYLTGLIVDSLTDS
HNPIGREECVQVLAKISELLGQDVFQIVQVEGNLKVYKWKPLEKNMLQPRL
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggtaattacaagtcacatggtcttggtcttggtttggtcttggtcttgtgaaacaccc
atacattgtggatggcatggcatggcatggcatagcagctcatctcatctcatctcatat
tgcacacagagcttaaagcaagtcagtcacttcggtgaaagtgaaaggcgtttgaacatt
ggtatagagacacctgcaagcaagcaagccccacccccccaagaaaccatgaatgcatac
aagtacacgccgccggtgattgatctggataaggtgggtaacgagacggacctgctgcct
ctcatgaagcagatcttgctaatgcacgatagcttcctgctgcagaattttgccaatatt
gatgctgtgcgcgagctgctggggtctgtggcgcaggaggacgggcccgcgtgtgcgctc
gatgcgtccttcgacggcgtgctcgaagctgggaatcactcgcttgaacagtgggtgtac
gtgaacgaccaagagacaagaccggaacatgctgagtcacgtgatgtacggcgtctgaga
gcgatcctgggcagaatcgcggtgtactttggcaagctgtgcttgcaagcactggagtgc
gcagaccgggacgcccttgttgcctcaggaaaccactcggcagtgctgtctcgtcaccat
tcgaagtttggtgaccaagtgctcgacctgcagttcgattactcggcaaccgaatggatt
gaattcaaatcggtagggctgctcaccgtggttccagatgctacctgcgcaaaagtgtac
agaaacgattcgtggcatggcattgatgtagaaaactgcatcttgcttcatacggggcct
gtcctggcctctgcatccagaggaatgcactctacttcagatctacgactttccacaaac
tcgctggcatacactgttcagccacatttggaataccgcatggcagatggaagatatttt
gccgaacacttcctagaattcaatctacaacggttcccagacattggcaaacaagcttat
ccggaagaaatgaagctcgttgctctaaagcgtagcgtttctctcttgaaaaccttcttt
accaccatggaatcgatgatcaatctctacaagataaaccaccctggcaccgacatggtt
gatttggaaacgatattacccagcatttcgaggatgatgagagttaaagtcacctcaaca
gacttccagaggttgctgtacatttggccacaagcatacgatattgacataaattcaaac
tgcggaatctccattaaacttcagactaccctctcgctcacaaagtcacggctcttagag
tttgcagagagaattgatcagtggtttcaaaatgcgaaaggctcaggtagcgttccagaa
gaaattcctccattaaaattgggcaaaagaaaggctagtaacggttctacatcaaccaca
tactcctcgtcgccttctaaaaatgtcgccaggcgtaaatttgcatctttgaaaggtaaa
ccaaaatctatgtcacttacttcttctctgaatcctacagtagtaacgcctaccaattac
ggggataatttaaccacggatgatgtgacaatggtagatccaaaatcatctcttctagat
agaattagagtcaaggaaagaagagcagctgcactactgtctcaacgtgaactaatgcaa
gatcatttcatagcgattaaaatgaaacatgtgttcgatatttgtttcaccttggagcca
gaggtcccatatactgaagactatttaacagggctcatcgttgactcattgacagacagc
cataacccaattggaagagaagaatgtgttcaggtccttgctaagattagtgagttactt
ggtcaagatgtattccaaatcgtacaagtggaaggtaacttgaaggtgtacaagtggaaa
ccattggagaaaaacatgctacaacctcgtttatag

DBGET integrated database retrieval system