KEGG   Kluyveromyces marxianus: KLMA_60371
Entry
KLMA_60371        CDS       T05269                                 
Symbol
DDC1
Name
(RefSeq) DNA damage checkpoint protein 1
  KO
K06663  DNA damage checkpoint protein
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx04111  Cell cycle - yeast
kmx04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLMA_60371 (DDC1)
   04113 Meiosis - yeast
    KLMA_60371 (DDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kmx03400]
    KLMA_60371 (DDC1)
DNA repair and recombination proteins [BR:kmx03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    KLMA_60371 (DDC1)
SSDB
Motif
Pfam: Rad9 MBA1
Other DBs
NCBI-GeneID: 34717587
NCBI-ProteinID: XP_022677444
LinkDB
Position
6:complement(777460..779151)
AA seq 563 aa
MSFKATINDNNNQLIWGKSLSTLSQINVDVFVTITKNGIILSSMNNTDTTMAKVRFPKDF
FTEFFFDPKKIVFGEAGVQQIYDCSDQLHTIYSFKINGKYLSLLSLKQEDQIKEYVLSID
NSDGCSESLANKLILKMRTNSLLNKEYQVIFDPLESIQIILSLKYKQKFLSVYNNSKETK
SVDPRLMEYFKTLQNELQEDMFNKGIANEHNIVTTVKNTPLTISDEINFLSFDQSILKNF
VESIMSNVIEEIKLELTRNSLNIIGFTKAIYNMKSEGYLKQAVTVTNTCSAHDLEHYCIF
SIENKENGSRPSSRSSNLKKSITFKLRDFKIFLNGLNCWKTNDMIRIWFCQPGDPILFEI
IKDGVILELVQVTDTDGRVEDSTPQETPTPTHTSVSPEKHISPIKKDNLVKLEKLNKPLT
RQPIYPHAKRSLFVQDLDNDDEAEDEAEGHEKKFKFKRWSNQQKTPEPDSNTESQSSEST
SNTHQSEPAKRMRTTVEWAGTYDKDIAERKGSYIKQIDKAAYLAGLKRQALEEPRKQTED
ALELENEEMGPTQVDQPKGLFDD
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgtcttttaaagcaacaatcaatgataataataatcagctaatatgggggaaatcattg
agtacactctcgcaaattaacgtggatgtttttgtcacaattaccaaaaatgggataata
ttatcttcaatgaataatacagatacaacgatggcgaaggtaagatttcccaaagacttc
ttcacagaatttttctttgaccctaaaaagattgtatttggagaggcaggagtacagcaa
atctatgattgtagtgatcaattacacacaatatacagtttcaagattaacgggaaatac
ctctcattattgtctttgaaacaagaagatcagattaaagaatatgttttatcaattgat
aactcagatggatgttctgaatcgttagcaaataagttgatactcaagatgagaaccaat
tctttgcttaataaggaatatcaagttatttttgatccattggagagtatccagatcata
ttgagtttgaagtacaagcagaagtttctttcggtttacaataattctaaagagaccaaa
tctgtggatccgcgtttaatggaatatttcaagactcttcaaaatgaactacaggaagat
atgtttaataagggtattgcaaatgagcataatattgtaactacagttaaaaatacgcca
ttgaccataagtgatgaaataaactttcttagttttgatcaatcaattcttaagaacttt
gttgagtccatcatgtcaaatgttatagaagagattaagttagagctcacccgtaattct
ttgaacattataggatttacaaaagctatttataatatgaaaagcgaaggatacttgaaa
caagcggttactgtaacaaatacgtgtagtgcccatgatcttgagcattactgcatattc
tctattgagaacaaagaaaatggaagccgaccatctagtaggtcatctaacttgaagaag
agcatcacgttcaaactacgagatttcaaaatattcctgaacggattgaattgttggaaa
actaacgatatgattcgcatttggttttgtcaaccaggagatccaatcttatttgaaatc
atcaaggatggtgtgatattagagttagttcaggtaactgacacggatggaagagtggaa
gattcaacgccacaagaaacgcctacccctacacatactagcgtatcgccggagaaacat
atttccccaataaaaaaagataatctagtgaaactagaaaagctaaataagccattgact
agacagccaatatacccgcatgcgaagagatcactatttgtacaggatttggacaatgat
gatgaagccgaggatgaagctgaggggcacgagaaaaaatttaaattcaagcgatggagt
aaccagcagaaaacaccggaaccggactcaaacacagagtctcaatcatcggaatctacc
agcaatacccaccaaagtgaacccgcgaagagaatgcgaaccacagtagagtgggctgga
acctatgataaggatattgctgagagaaagggctcttacataaaacagatagacaaagcg
gcatatctagcaggtcttaagagacaggctcttgaagaaccaagaaaacaaacagaagac
gcactggaactggagaacgaagaaatgggtcctacccaagtagatcaacccaaaggcttg
tttgacgactaa

DBGET integrated database retrieval system