Huiozyma naganishii: KNAG_0B00420 Help Entry KNAG_0B00420      CDS       T08174                                  Symbol KNAG0B00420 Name (RefSeq) hypothetical protein   KO K12691   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 5 Organism kng  Huiozyma naganishii Pathway kng00510   N-Glycan biosynthesis kng00513   Various types of N-glycan biosynthesis kng01100   Metabolic pathways kng04141   Protein processing in endoplasmic reticulum Module kng_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:kng00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     KNAG_0B00420 (KNAG0B00420)    00513 Various types of N-glycan biosynthesis     KNAG_0B00420 (KNAG0B00420)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     KNAG_0B00420 (KNAG0B00420) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DMT_YdcZ AglB_L1 DUF3382 CrgA Motif Other DBs NCBI-GeneID:  34524141 NCBI-ProteinID:  XP_022462737 UniProt:  J7S4D4 LinkDB All DBs Position 2:complement(<71887..>72259) Genome browser AA seq 89 aa AA seqDB search MAYEELFKDLQSTATVGPIIALDLQPRYAMVAAIVTLLLGSFALVVLYSNEGNKLSLSKI SKYTLLSGLASVFFALATIFTSNSFGVYV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggcatacgaggaactatttaaagatttgcagtccactgccacggtaggcccaattata gctctggacttacagccgaggtatgcaatggttgccgcaatcgttacactgctgctcggg tcgttcgcgctcgtggtgctctactccaacgagggcaacaaattatccctgtcgaagatc tcgaagtacactctgttgagtggactagcgagcgtgttctttgctcttgcgacgatattc acttcgaactcttttggtgtctacgtctga

DBGET integrated database retrieval system