KEGG   Kazachstania naganishii: KNAG_0I00320
Entry
KNAG_0I00320      CDS       T08174                                 
Symbol
KNAG0I00320
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
kng  Kazachstania naganishii
Pathway
kng04111  Cell cycle - yeast
kng04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KNAG_0I00320 (KNAG0I00320)
   04113 Meiosis - yeast
    KNAG_0I00320 (KNAG0I00320)
SSDB
Motif
Pfam: CDT1_C
Other DBs
NCBI-GeneID: 34527566
NCBI-ProteinID: XP_022466068
LinkDB
Position
9:complement(42524..44308)
AA seq 594 aa
MAHSSQLPVIDLDKVGDEAQLLPIVRGILTTNDTFLVKNYANRLEVARLLETMREPSVAQ
GFDANFTGTLALGDDGQPLLEQYIENVSSSTANGGPGLQFDRHCQNGELLKVYHKLLKIV
RFFAQLCLQSVGVSGVSLENEYATKLTRFHYDGQSVQEDTDVVDAVDDTFKYYFDSAPQN
GGAEYTTHRSAGLLTVFPSTEHVRFKPPTTSIDDNIWCSAVDTQEDCLLFHTGGLLAAWS
NGMHATSPLQLDTRSKMVHLTVFPPLDTPWNGSTVANLLLRQQIEEWPQVARAYYPRELA
EQQLFKRIKFYKDLFAVCETVVSLYTISRANLVAPELNVLLPQMTNLMKKKITADDFLKM
TQLWDDCYILECNSMGELTLKVPRQDPLQQLTNSSRRLTYVSRADEWYAYSITLARIPQD
VPSRRINKRRGSSSNSHNNENGIKDSKTRANNMVSTRYLCNNKQQYVTGEKPRDTQNNLL
ERLREREKKSAILLNERERKYQQFLATKMRQIFDILMSLDAGVPYTETYLCGLIVDSLQD
SNNPIGTHEAQEILVKINGVVPNQIRMRAVDGGLKVFKISYLNRDEFLTTLPVN
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcacactcttctcaattgccagtgattgatttggataaagtgggcgatgaggcacag
ttgttgcccatcgtgcgtgggattttgacgactaatgatacgtttctagtgaaaaattac
gctaataggttggaggtcgctcggttgttggaaacaatgcgtgaacctagtgtggcacag
gggttcgatgccaatttcacggggacgcttgccctgggggacgatggacaacccctcttg
gaacagtacatagaaaacgtctcctcgtctactgcaaatggtggtcccgggttgcaattc
gatagacactgtcaaaacggggaattgctcaaagtgtaccataagctgctcaaaatagta
aggttttttgcacaactgtgtcttcaatcagtaggagtatctggtgtatccttggagaat
gaatacgctacgaaattgaccagattccattacgatggtcaatcggtccaagaggatacc
gatgtggttgacgcagtggatgacactttcaaatactatttcgattcggcaccacaaaat
ggtggagcagagtatacaacacatagatctgcaggtttactcactgttttccccagtaca
gaacatgtcaggttcaagccaccaacaacatccatcgacgataacatatggtgttcagcg
gtagacacgcaggaggattgtcttcttttccacactggggggcttcttgcagcatggtcc
aacgggatgcacgcaacttcccccttacaactggatacacggtctaaaatggtccatttg
actgttttcccaccgctagatacaccttggaacggatctacagtggctaacttgctcttg
agacaacagatcgaagaatggccacaagtggcaagggcttactacccaagggaactagct
gagcaacaactgttcaagagaataaaattctacaaagatttgttcgccgtgtgtgaaacc
gtggtgtctctgtacaccatctcgagagcaaacttggtcgcaccagaactaaacgtgctt
ctaccacagatgacaaacctcatgaagaagaaaatcacagctgatgatttcttaaaaatg
acccaactctgggacgactgctacattttggagtgtaactccatgggggaactcaccctg
aaagtcccaagacaggaccctctgcagcaactcacgaactcgtcgaggagactcacatac
gtgtcccgcgcggacgaatggtacgcatacagcatcacacttgctcggatcccacaggat
gtcccttccagaaggatcaacaagagaagaggctcctcttcaaactcacacaacaacgaa
aacggcatcaaggattccaaaacacgtgcaaacaacatggtctccacgaggtatctgtgc
aataacaagcaacagtacgtcacgggggaaaaacctcgcgatacacagaacaatttactc
gaaaggcttcgggagagggagaaaaaatcagcgattttgcttaacgagcgggaacggaaa
taccagcagttcttagcgactaagatgagacaaatttttgacattctcatgtccctggac
gcgggcgtcccctacacagagacgtacctttgcggtctcatagtagactccctgcaggac
agcaacaacccaattggcacacacgaggctcaggagatcctcgtcaagatcaacggcgtg
gtacccaaccagatccgcatgcgtgccgtcgacggcggtctcaaagtattcaaaatctcg
tacttgaacagagacgagtttttgaccacgttgccagtcaactga

DBGET integrated database retrieval system