Kangiella profundi: CW740_05695 Help Entry CW740_05695       CDS       T05254                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpd  Kangiella profundi Pathway kpd01100   Metabolic pathways kpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CW740_05695    00074 Mycolic acid biosynthesis     CW740_05695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CW740_05695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Ribosomal_L50 HLH DUF1493 Motif Other DBs NCBI-ProteinID:  AUD78772 UniProt:  A0A2K9AMD0 LinkDB All DBs Position 1218074..1218313 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKNIVVEQLGVKEEEVTAEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKINTVQAAIDYIKANVDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtactatcgaagaacgcgtaaaaaacatcgttgttgagcaattaggtgttaaagaa gaagaagtgactgctgaagcttcttttgttgatgatttaggtgcggattcattggatacc gttgaattggtaatggctcttgaagaagagttcgatactgagattccagacgaagaagct gagaaaatcaacacagttcaagccgctattgactacattaaggcgaatgttgacgcgtaa

DBGET integrated database retrieval system