KEGG   Legionella antarctica: TUM19329_12980
Entry
TUM19329_12980    CDS       T07713                                 
Name
(GenBank) acylneuraminate cytidylyltransferase
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
lant  Legionella antarctica
Pathway
lant00541  O-Antigen nucleotide sugar biosynthesis
lant01100  Metabolic pathways
lant01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:lant00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    TUM19329_12980
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: BCA94937
UniProt: A0A6F8T452
LinkDB
Position
1366968..1367693
AA seq 241 aa
MINQKKVLAIIPARGGSKGLPGKNIRPLNGMPLVAWPIQTALNSKYIDRVIVTTDDPEIA
KIAQEYGAEVPFIRPAEFAKDTSPSSEAIIHAIQFCTETDGTYDYTVLLEPTSPLTESSD
VDRALETLVSSKGLAIVGTCKVEATHPVYCATIGEDSLLKPFNRDNFAKPIRRQDVDELF
FFEGSLYISEVKKYLETQTFYHELTLPYVVPAWKALEIDTLLDFFKVEAVMKNKELLNLI
N
NT seq 726 nt   +upstreamnt  +downstreamnt
atgattaatcaaaagaaagttctcgcaataataccagccagaggtggtagtaagggtcta
ccagggaaaaacattcgaccattaaacggcatgcccttagtcgcgtggccgatacaaacg
gctttaaactctaaatatattgatcgtgttattgtaacaacagatgacccggaaattgca
aaaatagcacaggaatatggtgctgaagtaccctttatacgtcctgcggaatttgcaaaa
gatacttcaccttcctcagaagcaataattcatgccatccaattctgtacagaaacagac
ggtacttacgactataccgtattgttggaacctacttcacctttaacagaatcttccgat
gttgatagggccctggaaactttagtttcaagtaaaggattggccattgtaggtacatgt
aaagtagaagcgacccatccagtttattgtgccactattggtgaggatagtttattaaag
ccatttaacagagataactttgcaaaaccgattcgaagacaagatgtagacgagcttttt
ttctttgaaggttcgctttatatttctgaagtcaaaaaatatttggaaacacagaccttt
tatcacgaacttactctaccctatgtagttcctgcctggaaagcactcgagattgatacc
ctcctggatttctttaaagttgaagcggtgatgaagaataaagaattattgaatttaatt
aattaa

DBGET integrated database retrieval system