KEGG   Lentibacillus amyloliquefaciens: AOX59_08505
Entry
AOX59_08505       CDS       T04204                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
lao  Lentibacillus amyloliquefaciens
Brite
KEGG Orthology (KO) [BR:lao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lao03000]
    AOX59_08505
Transcription factors [BR:lao03000]
 Prokaryotic type
  Other transcription factors
   Others
    AOX59_08505
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_1
Other DBs
NCBI-ProteinID: ALX48646
UniProt: A0A0U4F4X9
LinkDB
Position
complement(1698072..1699043)
AA seq 323 aa
MRRLSIFVLATFIVIFLSGCSNYFDSGDLQNAGMLVETTIHDQPWNEKGYEGLLSIEEEF
GVDVFYKEDVKTQADVREAVDELVSNGVNLIFGNSSAYGQFFEDISATYPEVHFVYFNGG
QFGEDVTSLNFNAHAMGFFAGMMAGEMTETNRVGVIGAFEWQPEIEGFFEGVTYQNPEAE
VNFNYVNDWNGNELAMDMYKTMRDDGTDVIYPAGNAYSHSIIEQANQDGIYAIGYVADQS
EIAEETVLTSTVQHLSELYTLAAKEFNEGDLRGGVMTYDFQDDMISLGKLSPDVPEEFQK
VIQEEIEAYKESDLLPHESSHDE
NT seq 972 nt   +upstreamnt  +downstreamnt
ttgagaaggctatctatcttcgtattggcaacgttcatagtaatttttttatccggctgc
agcaattattttgattccggtgatctgcaaaatgccgggatgcttgtcgaaacaaccatt
catgatcagccatggaatgaaaagggatatgaaggattgctttcaatcgaggaagaattc
ggtgttgatgttttttataaagaagatgttaagacgcaagcagacgtaagagaagcggtt
gatgaattggtcagcaatggcgtgaacttaatattcgggaacagcagtgcatatggacaa
ttttttgaagatatttcagcgacatacccagaggtgcatttcgtctattttaacggcggg
caatttggtgaagacgtgacaagtctcaatttcaatgcgcatgcgatggggtttttcgcc
gggatgatggcaggtgaaatgaccgaaactaatcgtgtgggcgttattggtgcgttcgaa
tggcagcctgaaatcgaaggcttttttgaaggtgttacatatcagaaccctgaggccgaa
gtgaatttcaattatgtcaatgactggaacggcaatgagcttgcgatggacatgtataaa
acaatgcgggatgacgggacagatgtcatttaccccgccggcaatgcctacagtcattca
atcattgaacaggcaaatcaggatggaatatatgcaatcggttatgtcgctgatcaatcg
gaaattgctgaggaaactgttctgacaagtactgtacagcatctctcggaattatataca
ttggcggcaaaggaatttaatgaaggtgatcttcgcggcggcgttatgacttatgatttc
caggatgatatgatttcacttggaaaattaagtccggatgttcctgaggaatttcaaaaa
gtgatacaagaggaaatcgaagcctataaggaatcagatctgctgccgcacgaaagcagc
cacgacgaataa

DBGET integrated database retrieval system