Labrenzia sp. CP4: ACP90_14460 Help Entry ACP90_14460       CDS       T04295                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism lap  Labrenzia sp. CP4 Pathway lap02024   Quorum sensing lap03018   RNA degradation Brite KEGG Orthology (KO) [BR:lap00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ACP90_14460  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ACP90_14460  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lap03019]     ACP90_14460    03036 Chromosome and associated proteins [BR:lap03036]     ACP90_14460 Messenger RNA biogenesis [BR:lap03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ACP90_14460 Chromosome and associated proteins [BR:lap03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ACP90_14460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  AMN53432 LinkDB All DBs Position 3101417..3101671 Genome browser AA seq 84 aa AA seqDB search MAERAQNLQDTFLNHVRKQKTPLTIFLINGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHA ISTIMPNGPVQLFDQAEENAEKAS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctgagcgcgcacaaaatctccaagacacttttcttaatcacgttcgcaagcaaaaa actcctctgacgatttttctgatcaacggtgtgaaattgcagggtgtcgttacctggttc gacaacttctgcgttctgctgcgtcgtgatgggcattcccagctggtttacaaacacgcg atttccacaattatgccaaacggacctgttcaactgttcgatcaggctgaggaaaacgct gaaaaggcaagctga

DBGET integrated database retrieval system