KEGG   Loxodonta africana (African savanna elephant): 100660007
Entry
100660007         CDS       T04351                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100660007 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    100660007 (TNFRSF8)
   04090 CD molecules [BR:lav04090]
    100660007 (TNFRSF8)
Cytokine receptors [BR:lav04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100660007 (TNFRSF8)
CD molecules [BR:lav04090]
 Proteins
  100660007 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100660007
NCBI-ProteinID: XP_023408254
LinkDB
Position
Unknown
AA seq 712 aa
MHAFRAVLGLLLLRALRAPPTDRGPEDICAGDPNRYYDKDAGKCCYRCPSGDFPEKQCVQ
SSTDCGKQCGSDHYLNEAGRCTACVTCSGDDLVEKTPCTRNSSRVCECRPGKFCATSAAN
SCARCLLHTICPPGMIVKLQGTAERNTVCEPAPTGARPGCSTSPENCKTSASTTLEAMSS
LTSPATSSARTMPHGGGPVHATEDASKLTRPPHAPSSAGKPSPDPGLSPQHPCPQGSADC
RKQCGPDYYLDEAGRCTACVSCSRDDLVEKTPCTWNSSRVCECRPGMVCATSATNSCARC
ITRSICPSGMAARLQGKQSPPQPRGPAGMPLGVTSLCRLGLSWTDSKTMLSPAGTASRDT
TSELPPSGTHPDCLTSPEDREMPSSSTIPTLMSPLDSETSKRHGGSTTYAREDTSTPTSA
PVAVSSMEKPVLVTVRAGSDTGAGFQFWLGKGSGTLSHKGIQVPGDGGRSPGLGLSCVVV
ARASAHCSRRRAELSGRFCVSGPVVFWVTMVLLVILFSGIFLLCHWKACRRGIQQKLHLC
FPGQNFRTKPEPGDSRPGRKPTEPCRIVSVVEPGPEEQGLMSVPAVETCPSVGTACLESL
RLLEASPVEGPSSPRGPPEPRATTEHTNNKIEKIYIMKADTVIVGTVKTEVPESRGLAVS
VGPEFEEELEVDHAPHYPEQETERPLGSCEDVMFSVEEEGKEESLTTTISEK
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgcacgccttccgtgctgtgctgggactgctgctcctccgggctctccgagcccccccg
acggatcgaggccccgaggacatctgtgctggagaccccaaccgctactatgacaaggat
gctgggaagtgctgttaccgctgcccctcaggtgactttcctgagaagcagtgtgtgcag
tcctccactgactgcgggaagcagtgtgggtctgaccactacctgaatgaggccggccgc
tgcacagcctgtgtgacctgctcaggagatgaccttgtggaaaagacaccctgcacaagg
aactcctcccgcgtctgtgaatgtcgacctggaaagttctgtgccacatcagccgccaac
tcctgtgcccgctgcttactccacaccatctgcccaccagggatgattgtcaaactccag
ggcacagctgaaaggaacactgtctgtgagccagctcccacaggggcccgtcctggctgc
agcaccagcccagagaattgcaagacatctgccagcaccaccctcgaggccatgtccagc
ctgacctccccggccacctctagtgccaggaccatgccccacggagggggcccagtccat
gccacagaagatgcttccaaactgacgaggcctccccacgctccctcctctgcagggaag
cccagcccagatccagggctgtccccacagcatccatgcccacaggggtctgctgactgc
aggaagcagtgtgggcctgactactacctagatgaggctggtcgctgcacagcctgtgtg
agctgctctagagatgaccttgtggagaagacaccctgcacatggaactcctcccgtgtc
tgcgaatgtcgacctgggatggtttgtgccacatcagccaccaactcctgtgcccgctgc
atcacccgctctatctgcccatcagggatggccgccagactccagggtaagcagtcccca
ccccaaccaaggggccccgctgggatgcccctgggagtcaccagtctctgccggttaggc
ctttcctggactgattctaagacgatgctgtcccctgcaggtacggcttcgagggacacc
acctctgagctgcctccctcagggacccaccctgactgcctcaccagcccagaggacaga
gagatgccttccagcagcaccatccccactttgatgtccccactggactccgagaccagc
aagaggcatggagggagcaccacctatgcccgggaggacacctccaccccaaccagtgct
cccgttgctgtctcctccatggaaaagcccgttctggttacagtgagggctgggtcagat
acaggggctgggtttcagttctggcttgggaaagggtcgggtactctcagccacaaggga
atccaggtcccaggggatggaggaaggagtccaggcctagggctgtcctgtgtggttgta
gctagggcctcggctcactgctctcggcgcagggcagagctttcagggcgcttttgtgtt
tcaggacctgtggttttctgggtgactatggtgttgctggtgatcctgttctctggcatc
ttcctcctgtgccactggaaggcctgcaggagggggattcagcagaagctccacctatgc
ttcccaggccagaacttccggaccaagccggagcctggggattccaggcctgggaggaag
cccacagagccctgcagaatcgtgtcggtggtggagccaggcccagaagagcaggggttg
atgagtgtcccagctgtggagacctgccccagcgtgggaaccgcctgcctggagagcctg
aggctgctggaggccagcccagttgagggtccctcctcccccaggggccccccagagccc
cgggcaaccacggagcacaccaataacaagattgagaaaatctacattatgaaggccgac
acggtgattgttgggaccgtgaagaccgaggtgcctgagagccggggcctggcagtgtcc
gtggggcctgagtttgaggaggagctggaggtggaccatgccccccactatccagagcag
gagacagagcggcctttgggcagctgtgaggatgtcatgttctctgtggaggaggaaggg
aaggaggagtccttgaccacgaccatctctgagaagtga

DBGET integrated database retrieval system