KEGG   Laccaria bicolor: LACBIDRAFT_295571
Entry
LACBIDRAFT_295571 CDS       T01044                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
lbc  Laccaria bicolor
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LACBIDRAFT_295571
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     LACBIDRAFT_295571
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 6083447
NCBI-ProteinID: XP_001887807
JGI: 295571
UniProt: B0DV60
LinkDB
AA seq 386 aa
MTRKVNCILYLLRVNFASIALALSSTTVLAFPSYGSLAGLSEAELDRIIPLLEARNAGPP
PGPLKNTSTKLVNDKNHPWKPLGYGDIRGPCPGLNTLASHGWLPRNGIATPAQIVNAVQE
GFNMGNDLAVFVTYAAHLVDGNQVTDLLSIGGKTPQTGPDPPAPAIVGGLNTHAVFEGDA
SMTRGDAFFGDNHSFNETQFDEFSAFSNKFGGGYYNLSVAAEFRWQRIQESIATNPNFSL
ISPRYFTAYAESVFPLVFFVDGRVSDGRLSLPNARGFFQNSQMPKDFFRPNQSIGLNEIG
DGISAIASAHPIAPGKNEGVGNYVLDPTSADFDHFCLLYINFVNQTVKSLYPNPKGVLLD
ALKRNLNNFYGPLNGSDCEQIFPYGK
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacccgaaaggtcaactgcattttatatctcctgcgtgttaacttcgcttctattgcc
ctggcattatcttccaccactgtactagcattcccatcatacggctcccttgctgggctt
tcagaggcggaattagaccgtattattcccttgctagaagctcgtaacgctggccctcct
cctggaccactgaagaatacttcaacaaaattggtcaacgacaagaaccacccctggaag
cctctcggatatggcgatattcgaggtccttgccctgggttaaacacactggcctcccat
gggtggcttcctcgaaacggcatcgctactccggcgcaaattgtcaacgcggtgcaggaa
ggattcaatatgggaaatgatttggcggtcttcgtcacatacgctgcgcatctcgttgac
ggcaatcaggtcacggacttgcttagcatcggtggaaagacgcctcaaacaggccctgac
ccgcccgcgcctgccattgtcggtggtctcaatacgcacgccgtatttgaaggtgatgca
agtatgactcgaggagacgcatttttcggagataaccacagctttaacgaaacacagttt
gatgaattttctgccttcagcaacaaattcggcgggggatactacaatttgagcgtagca
gccgagtttagatggcagcgcattcaagaatctattgcgacgaacccaaacttttctctc
atctccccccgttacttcacggcgtatgccgagtccgtgtttcccctggtattcttcgtc
gacggccgcgtatcagacggacggcttagcctaccgaacgcgcgtgggttcttccagaat
agccaaatgcccaaagacttcttccggcccaatcagtctatcggcctcaacgaaattggt
gatgggattagcgctattgctagtgcccaccctattgcgccgggaaagaacgagggagtt
gggaactatgtcctcgaccctacatctgcggatttcgaccatttctgcttgctttacatc
aacttcgtcaaccagaccgtaaagtcactctaccccaatcccaaaggcgttttgctcgat
gccttgaagaggaatctcaacaatttctacggcccactcaacgggtcggattgtgagcag
atcttcccttatggaaagtag

DBGET integrated database retrieval system