KEGG   Leishmania braziliensis: LBRM_35_6720
Entry
LBRM_35_6720      CDS       T01113                                 
Name
(RefSeq) putative methylenetetrahydrofolate reductase
  KO
K25009  methylenetetrahydrofolate reductase [NAD(P)H] [EC:1.5.1.20]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00670  One carbon pool by folate
lbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LBRM_35_6720
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LBRM_35_6720
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-GeneID: 5420268
NCBI-ProteinID: XP_001569284
UniProt: A4HQF9 A0A3P3ZK52
LinkDB
Position
36:complement(2481352..2482281)
AA seq 309 aa
MSGLISDAIAAEDANKWYTSYEFYPPRSEKAEENFMKVQIPNFMRQSPVFLDLTWGAGGR
TSETTMRLCKDLQNAYPDTPINMHITCTNMSHDLIKETLDFAKEHGIRNILALRGDPPRG
DEFQSNPEGFTCARDLVRYIHATYGDYFCVSVAGYPEGHPSRIAEDGTILDEDHQKELEY
LKEKVDAGASVVITQLFYDASLYVKFVKDCREMGITVPIIAGLLPITTYAGFTRMVSLCK
TRVPGDVKKRVEELKENPEALKEYGVEQCVQMIERIRASGLDYHHLHFYTLNSSAQTFQV
LKRLNALVE
NT seq 930 nt   +upstreamnt  +downstreamnt
atgtccgggctcatcagtgacgccatcgctgccgaggatgccaacaaatggtacacctcc
tatgagttttatccccctcgcagtgagaaggcggaggagaactttatgaaggtgcaaatc
cccaattttatgcgacagtcgccagtcttcctcgacctgacgtggggcgctggtggtcgc
acgagtgaaaccacgatgcgcctctgtaaggacctccagaatgcataccctgacacaccc
atcaatatgcatatcacgtgcaccaacatgtcgcatgatctcatcaaggagacgcttgac
ttcgcaaaggagcatggcattcgcaacatcctcgctctccgtggagacccgcctcgtggt
gatgagttccagtccaacccggaaggctttacgtgcgcgagagatcttgtgcgctacatt
cacgccacatacggcgactacttttgcgtgtcggtcgccggctaccccgagggccacccg
agccgtatcgccgaggacggcaccatcttggatgaggaccaccagaaggagctggagtac
ctcaaggagaaggtagacgctggtgccagcgttgtcatcacgcagctcttctacgatgcc
tccctgtacgtgaagtttgtgaaggactgccgggagatgggcattacggtccccattatc
gccggacttcttcccatcacgacctacgccgggttcacgcggatggtgtcgctgtgtaag
acgagagttcccggtgatgtgaagaagcgggtagaggagctcaaggagaaccccgaggct
ctcaaggagtacggcgtggagcagtgtgtgcagatgattgagcgcattcgcgcctctggg
ctcgactaccaccaccttcacttctacacgctcaacagcagtgcgcagacgttccaagtc
ctaaagcggctaaatgcgctggtggaatga

DBGET integrated database retrieval system