Lemur catta (Ring-tailed lemur): 123620357 Help Entry 123620357         CDS       T08326                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04060   Cytokine-cytokine receptor interaction lcat04061   Viral protein interaction with cytokine and cytokine receptor lcat04062   Chemokine signaling pathway lcat04620   Toll-like receptor signaling pathway lcat05142   Chagas disease lcat05163   Human cytomegalovirus infection lcat05323   Rheumatoid arthritis lcat05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123620357    04061 Viral protein interaction with cytokine and cytokine receptor     123620357  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123620357    04062 Chemokine signaling pathway     123620357  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     123620357   09174 Infectious disease: parasitic    05142 Chagas disease     123620357   09163 Immune disease    05323 Rheumatoid arthritis     123620357   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123620357  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123620357    00536 Glycosaminoglycan binding proteins [BR:lcat00536]     123620357 Cytokines and neuropeptides [BR:lcat04052]  Cytokines   Chemokines    123620357 Glycosaminoglycan binding proteins [BR:lcat00536]  Heparan sulfate / Heparin   Chemokines    123620357 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  123620357 NCBI-ProteinID:  XP_045381477 LinkDB All DBs Position 15:24125029..24126435 Genome browser AA seq 93 aa AA seqDB search MQVPVAALAILFFTEALSPHTCSASFGAGTPTACCFSYISRQLPLKFVDDYSETSSQCSK PAVIFLTKRGRQVCADPSEAWVQEYVTNLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcaggtgcccgtggccgcccttgccatcctgttcttcacggaggccctctccccccac acctgctctgcctcatttggagccggcaccccgaccgcctgctgtttctcctatatctcc cggcagcttccactcaaatttgtggacgactattctgagaccagcagccaatgctccaag ccagctgtcatcttcctcaccaagagaggccggcaggtctgtgctgaccccagtgaggcc tgggtccaggaatatgtcaccaacctcgagctgaatgcctga

DBGET integrated database retrieval system