Lates calcarifer (barramundi perch): 108875409 Help Entry 108875409         CDS       T04895                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04010   MAPK signaling pathway lcf04012   ErbB signaling pathway lcf04068   FoxO signaling pathway lcf04137   Mitophagy - animal lcf04140   Autophagy - animal lcf04144   Endocytosis lcf04150   mTOR signaling pathway lcf04210   Apoptosis lcf04218   Cellular senescence lcf04370   VEGF signaling pathway lcf04371   Apelin signaling pathway lcf04510   Focal adhesion lcf04540   Gap junction lcf04625   C-type lectin receptor signaling pathway lcf04810   Regulation of actin cytoskeleton lcf04910   Insulin signaling pathway lcf04912   GnRH signaling pathway lcf04916   Melanogenesis lcf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108875409    04012 ErbB signaling pathway     108875409    04370 VEGF signaling pathway     108875409    04371 Apelin signaling pathway     108875409    04068 FoxO signaling pathway     108875409    04150 mTOR signaling pathway     108875409  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108875409    04140 Autophagy - animal     108875409    04137 Mitophagy - animal     108875409   09143 Cell growth and death    04210 Apoptosis     108875409    04218 Cellular senescence     108875409   09144 Cellular community - eukaryotes    04510 Focal adhesion     108875409    04540 Gap junction     108875409   09142 Cell motility    04810 Regulation of actin cytoskeleton     108875409  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108875409   09152 Endocrine system    04910 Insulin signaling pathway     108875409    04912 GnRH signaling pathway     108875409    04916 Melanogenesis     108875409  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108875409  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcf04131]     108875409   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108875409    04031 GTP-binding proteins [BR:lcf04031]     108875409 Membrane trafficking [BR:lcf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     108875409  Endocytosis   Macropinocytosis    Ras GTPases     108875409 Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    108875409   Exosomal proteins of colorectal cancer cells    108875409 GTP-binding proteins [BR:lcf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108875409 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  108875409 NCBI-ProteinID:  XP_018519847 UniProt:  A0A4W6EHK6 LinkDB All DBs Position LG10:17588029..17602368 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtaggagctggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcatac aggaaacaagtcgtgatcgatggagagacctgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctatgt gtctttgccatcaacaacaccaagtccttcgaggacattcaccagtacagagaacagatt aaacgtgtaaaggattcagatgatgttcccatggtgcttgtgggaaacaaatgtgacctg ccagcacgcacggtggacacaaggcaagcccaggaactcgcccgctcctacggcatccct tacattgagacctctgccaagacacgacagggagtagaggatgccttctacacactggtc agggagatcagacagcataaactgaggaagctgaacccacctgatgagagcggtcaggat tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system