Latimeria chalumnae (coelacanth): 102346821 Help Entry 102346821         CDS       T02913                                  Symbol RPA3 Name (RefSeq) replication protein A3   KO K10740   replication factor A3 Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm03030   DNA replication lcm03420   Nucleotide excision repair lcm03430   Mismatch repair lcm03440   Homologous recombination lcm03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:lcm00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102346821 (RPA3)    03420 Nucleotide excision repair     102346821 (RPA3)    03430 Mismatch repair     102346821 (RPA3)    03440 Homologous recombination     102346821 (RPA3)    03460 Fanconi anemia pathway     102346821 (RPA3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lcm03032]     102346821 (RPA3)    03400 DNA repair and recombination proteins [BR:lcm03400]     102346821 (RPA3) DNA replication proteins [BR:lcm03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     102346821 (RPA3) DNA repair and recombination proteins [BR:lcm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      102346821 (RPA3)    MMR (mismatch excision repair)      102346821 (RPA3)   DSBR (double strand breaks repair)    HR (homologous recombination)      102346821 (RPA3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac-A_3 Motif Other DBs NCBI-GeneID:  102346821 NCBI-ProteinID:  XP_005999520 Ensembl:  ENSLACG00000009032 UniProt:  H3AKT1 LinkDB All DBs Position Un AA seq 121 aa AA seqDB search MEDVSMVTRTRINSSMLAQYIGKPVCFIGRVKQIHPTGTSLVLSDGEGKNATIELSEPLE NELSGIIEVVGRVTSKATIAVASYLPFREDKDAFDLELYNETLKVIHEFPHCYPFSVTSS E NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggaagatgtgagtatggtgacgaggactcggatcaatagcagcatgctggcccagtac atcggcaagcccgtctgctttataggcagagtgaagcagattcacccaactgggacatca cttgttctttcagatggggaaggaaaaaacgcaaccatagaactaagtgaacctctagag aatgagctctcgggtatcattgaagtggttggaagggtcacaagcaaagcaactattgcg gttgcttcatacctgccattccgggaagataaagatgcttttgatcttgagctgtataat gaaactttgaaagtcatccatgaatttcctcactgctatccctttagtgttaccagtagt gagtaa

DBGET integrated database retrieval system