KEGG   Latimeria chalumnae (coelacanth): 102355663
Entry
102355663         CDS       T02913                                 
Name
(RefSeq) tumor necrosis factor receptor superfamily member 21-like
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102355663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lcm04050]
    102355663
   04090 CD molecules [BR:lcm04090]
    102355663
Cytokine receptors [BR:lcm04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102355663
CD molecules [BR:lcm04090]
 Proteins
  102355663
SSDB
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Other DBs
NCBI-GeneID: 102355663
NCBI-ProteinID: XP_014344172
LinkDB
Position
Un
AA seq 357 aa
MDFRDWLILFWALLFITLSRTADLNMKAQPGEREHVSTIQTEICYVCPEGSGKLTDCPKN
KSECKECMEGRYLHRSYCTNCVKCPADRSWEIRAFIVVDLHVVPAGPWKRSSMEPNENLV
EVQSCSTTSQRMCECKAGMYCKIRLQETCSKCIPHTACLPETGVKVQDNAYTPIEISGIP
SVELIRGAWRTGTPFQNTECEECPVGTFSDEHSTIQKCLPHTDCAKLNKITVQQGNASWD
SICEDLPESTTRPATFRSVDIRTTASTAPDTTWPNSQGETGTCGKKTKKNSHESDHLLEN
SSITTVENFSTCVSKIPKEPNGEPVLNETPQTKESVPYHVTEHQGGDHANNKIVLKA
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggattttagagactggcttattctcttctgggctctcctgttcatcactttatcaaga
acagctgacttaaacatgaaggctcagcctggagaaagagaacatgtttcgaccatccag
actgagatctgctacgtgtgtcctgaaggttctggaaagctaacagattgccccaagaat
aaaagtgaatgtaaggaatgtatggaaggacgttatttacacagatcttattgtactaac
tgcgtgaaatgcccagcagacagaagttgggaaatacgtgccttcatagtcgttgatctg
catgtggtccctgcagggccctggaagaggtccagcatggagccaaacgaaaacctggtg
gaagttcagagctgctccactacctctcaaaggatgtgtgagtgtaaggcagggatgtat
tgtaaaatccgcttacaagaaacttgtagcaaatgcattcctcacactgcctgcctgcct
gaaactggagttaaagtacaagataatgcttacactccaattgaaatttctggaattccc
tctgtggaattaatacggggagcatggaggacaggtactccattccagaacacagaatgt
gaagaatgtccggtaggaaccttctcagatgaacattcaactattcagaagtgccttcca
cacacagactgtgccaagctgaacaagatcacagttcagcaaggaaatgccagctgggac
agtatctgtgaggacctgccagaatctaccactagacctgcaacatttagaagtgtagat
atcagaactacagcctctactgctccagatacaacatggccaaactcccaaggggaaact
ggaacctgtggaaagaagactaagaagaattctcatgaaagtgaccacctcctggaaaat
agcagtattactacagtggagaacttctctacctgtgtctccaagataccaaaggaacct
aatggagaaccagtcctgaatgaaactcctcagaccaaggagagtgttccttaccatgtg
actgaacaccaaggtggagatcacgctaataacaagattgttttgaaagcctga

DBGET integrated database retrieval system