Lactobacillus crispatus: LCRIS_01351 Help Entry LCRIS_01351       CDS       T01222                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism lcr  Lactobacillus crispatus Pathway lcr00362   Benzoate degradation lcr01100   Metabolic pathways lcr01120   Microbial metabolism in diverse environments lcr01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:lcr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LCRIS_01351    00622 Xylene degradation     LCRIS_01351    00621 Dioxin degradation     LCRIS_01351 Enzymes [BR:lcr01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      LCRIS_01351 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF1002 Motif Other DBs NCBI-ProteinID:  CBL50798 UniProt:  D5GYD9 LinkDB All DBs Position complement(1357261..1357440) Genome browser AA seq 59 aa AA seqDB search MPFVHIELIKGRSDEQITNLMKDVTEAVHKNTGAPKEHIHVIINELGKHTYGQGGEWRA NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgccatttgtacatattgaattaattaaaggtcgctcagatgagcagattactaactta atgaaggatgttactgaagcagtgcacaagaatactggtgcgcctaaggaacacattcat gtaattattaacgaattaggtaagcatacttatggccaaggcggcgagtggagagcttaa

DBGET integrated database retrieval system