KEGG   Leptinotarsa decemlineata (Colorado potato beetle): 111506757
Entry
111506757         CDS       T07512                                 
Name
(RefSeq) cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
ldc  Leptinotarsa decemlineata (Colorado potato beetle)
Pathway
ldc00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ldc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    111506757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ldc00199]
    111506757
Enzymes [BR:ldc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     111506757
Cytochrome P450 [BR:ldc00199]
 Cytochrome P450, animal type
  CYP306 family
   111506757
SSDB
Motif
Pfam: p450 DUF22
Other DBs
NCBI-GeneID: 111506757
NCBI-ProteinID: XP_023017728
LinkDB
Position
Unknown
AA seq 295 aa
MAPYFVESHTCTKIVLQIFTTFIRFRFLPKYQRTMKFLLDGKHKTHELYQKIIDEQVGDL
NSNKSATNILQAFLLERTRRNEEIVNKFYNDQQFYHLLADLFGAGLDTTLTTLRWYLMYL
AKNKSIQENIRSEINDVLQGRPPTLEDMPHLPLLEASICEAQRIRPVVPVGIPHGTMAEL
VIEGYRIPKGTMIVPLQWAMHMNEEVWNDPEKFDPYRFLDDEGKVVKNAHFMPFQIGKRM
CVGDELARMILFLFVTTIIQNFSFVLENEEVDFSGECGITLTPKSHKIKFSKIMK
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcgccctactttgtagaaagtcacacatgtaccaaaattgtccttcaaatattcaca
actttcattcgttttagatttcttccaaaatatcaacgtacaatgaagtttctattggat
ggtaaacacaaaacgcatgagctttatcaaaaaattatcgatgaacaagtaggtgacctt
aactccaataaaagtgctactaatatattacaagctttccttctggagagaactcggaga
aatgaagaaattgttaataaattctacaatgaccagcagttctaccacttgctggctgat
ttatttggtgcaggtttagacactactttgaccacattaagatggtacttaatgtacttg
gcgaaaaataaatcaatccaggaaaatattcgttcagagatcaacgatgttcttcaaggt
cgacctcctactttggaagatatgcctcaccttccactcctcgaagcatctatctgcgaa
gctcaacgaattcgaccagtcgtaccagttggtattccacatgggactatggccgaattg
gtcatcgagggatatagaattcctaaaggaaccatgatagtacctctacaatgggcaatg
catatgaatgaagaagtctggaatgatccagaaaagttcgatccgtataggttcctcgat
gatgaaggaaaagtggtcaagaatgctcattttatgccgtttcaaataggaaaaagaatg
tgtgttggagatgagctggccagaatgatacttttcctgttcgttacaaccatcattcag
aatttttcctttgtcttggaaaatgaagaagtcgatttctctggagagtgtggaataaca
ttgacacccaaatcacacaaaattaaatttagtaaaattatgaaatga

DBGET integrated database retrieval system