KEGG   Leishmania donovani: LDBPK_366670
Entry
LDBPK_366670      CDS       T02289                                 
Name
(RefSeq) methylenetetrahydrofolate reductase, putative
  KO
K25009  methylenetetrahydrofolate reductase [NAD(P)H] [EC:1.5.1.20]
Organism
ldo  Leishmania donovani
Pathway
ldo00670  One carbon pool by folate
ldo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LDBPK_366670
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LDBPK_366670
SSDB
Motif
Pfam: MTHFR YAcAr Toxin_22
Other DBs
NCBI-GeneID: 13386632
NCBI-ProteinID: XP_003865778
UniProt: A0A3Q8IJZ9 E9BV23
LinkDB
Position
36:complement(2509293..2510222)
AA seq 309 aa
MSKLISDAIAAEDVSKWYTSYELYPPRSEKAEEDMMKVLVPNFMRQSPVFLDLTWGAGGR
TSDTTMRLCKDLQHAYPDTPINMHITCTNTPKGLINEALDFAKTHGIRNILALRGDPPRG
EEFRADPDGFACARDLVRYIHDTYGDYFCVSVAGYPEGHPSRIAEDGAISDEDHQKELEY
LKEKVDAGASFIITQLFYDASLYVQFVKRCREIGITVPILAGLLPITTYAGFVRMVSLCK
TSVPSDVKKRVEELKENPDGLKEYGVEQCVQMIECIRTSGLDYHHLHFYTLNNSAQTFKV
LKRLNALVE
NT seq 930 nt   +upstreamnt  +downstreamnt
atgtccaagctcatcagtgacgcaatcgccgccgaggatgttagcaagtggtacacctcc
tatgagctttacccccctcgtagcgagaaggcggaggaggacatgatgaaggtgctagtc
cccaactttatgcgtcagtcgccagtcttcctcgacttgacgtggggcgctggtggtcgc
acgagtgacacgacgatgcgcctctgcaaagacctccagcatgcgtaccctgacacgccc
atcaatatgcacattacatgcaccaacacgccgaaaggtctcatcaacgaggcgcttgac
tttgccaagacacatggcatccgcaacatcctcgccctccgcggcgacccgccacgtggt
gaggagttccgggccgacccggatggcttcgcgtgcgcgagggatcttgtgagatacatt
cacgacacgtacggcgactacttctgcgtgtcggtcgctggctaccctgagggccacccg
agccgcatcgccgaggacggcgccatctcagacgaggaccaccagaaagagctggagtac
ctcaaggagaaggtggatgccggagccagctttatcatcacgcagctcttctacgatgcc
tccctgtacgtgcagttcgtgaagcgctgccgggagataggcattacggtccccattcta
gcagggctgcttcccatcacgacctacgccgggtttgtgcggatggtgtcactgtgcaag
acgagcgttcccagcgatgtgaagaagcgggtagaagagctcaaggagaaccctgacggt
ctcaaggagtacggtgtggagcagtgtgtgcagatgattgagtgcattcgcacctctgga
ctcgactaccaccacctccacttctacacgctcaacaacagcgcgcagaccttcaaggtc
ctaaagcggctaaacgcgctggtggagtga

DBGET integrated database retrieval system