KEGG   Lodderomyces elongisporus: LELG_02050
Entry
LELG_02050        CDS       T01116                                 
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
lel  Lodderomyces elongisporus
Pathway
lel04111  Cell cycle - yeast
lel04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lel00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    LELG_02050
   04113 Meiosis - yeast
    LELG_02050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lel03400]
    LELG_02050
DNA repair and recombination proteins [BR:lel03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    LELG_02050
SSDB
Motif
Pfam: Rad9 CoV_nucleocap XisI DUF459
Other DBs
NCBI-GeneID: 5234220
NCBI-ProteinID: XP_001527221
UniProt: A5DXG3
LinkDB
AA seq 517 aa
MFLAEIENKRHKTLWSKSVIALQAVAEGINFSVREDGVSLSAINLSRTSHGEIFFKRLFF
SKYEVDFSNVMQDGFAPKTAITPSPSYSFLINSRHLATLFRNLDSNGLKYILLRVNWNKN
ASHTVKYKLLIEIKNKKMIIKKYQTGYLPISKKELSVATTYKEDYSRQTSNNRGDVNRVH
HIMIDLVIPRQFLEMVPTSAEDFKIDIKNDKILFGGFTKQIIKDRDYIKQPMAVTVTINL
EELADSNLVPNDTLDQLEPAARVLVNFGMRDFRNFLTLVGYFTSSASSYVDQFDEEYANL
GNQNDYFHIYFRQPGDPILFDFQSTLHVDVQFIQITAGDKSVEDGREIDPTVLRNRMTLE
APIVHRVAQSKELDAIREGERTTSATEQPQSPPNLPSRSRSHSRSRSDSHSLSRSRSRSA
SPESMRRFAFGRLLLANEGIDRTILKPLAAVHNETDRRSFSEPLQDVITYDQSNQGRFDN
DTEYSDSEEEAAPPLKRRLIENEEYGPTQVEKAKSIF
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgtttctagcggagatagagaataaacgacataaaactttatggtccaaatcagtgatt
gcacttcaggcagtagcagaaggaattaatttttcggtacgagaagatggagtctcactt
tcagctatcaatttaagcaggacttcacatggtgagatttttttcaaacgactgtttttt
agcaaatatgaggtggactttagcaatgtgatgcaagatggatttgcaccaaagactgca
atcactccgtctccctcatactctttcttgattaactcgcgtcatttggcaacacttttt
cgcaatttggattccaatggattgaaatacattctactacgcgttaattggaataaaaac
gcatcgcataccgttaagtacaaactactaatagagataaagaacaaaaagatgattatc
aagaaatatcaaacgggctatttaccaattagcaaaaaagaactttccgttgcaacaacg
tacaaagaagactattccaggcaaacaagtaacaatagaggcgatgtgaatagggtgcac
catatcatgatagatttggttattccccgacaatttttggagatggtgccgacttctgcc
gaggatttcaaaattgacattaagaacgacaagattctgtttggtggatttacaaaacaa
atcatcaaagaccgcgattatataaaacagcccatggctgttactgttaccatcaatctt
gaagaacttgccgatagtaatcttgtaccgaacgacacactcgatcaactagaaccagct
gctagagtattagtcaattttggaatgcgcgatttcagaaatttcctaacacttgtggga
tactttacatcgtctgcatcttcttatgttgatcagtttgacgaagagtatgcgaacttg
ggaaaccaaaacgactatttccacatctattttcgtcaaccgggtgatccaattttattt
gatttccagagcactctgcatgtagatgtgcaattcatacaaatcacggctggtgataag
agcgtagaagatggcagggaaatcgatcctactgttttaaggaacagaatgacattagag
gcaccaattgtacatcgtgttgctcaaagcaaagagttggatgccataagagaaggtgaa
aggactacatcggcaacggagcaaccccaatcaccgcccaacttgccctcccgttcacgt
tcacattcacgttcacgttctgactctcattccctttctcgttctagatcaagatctgct
tctccggaatctatgagacgttttgcttttgggcgactgcttcttgccaacgagggtatc
gatcgcaccattttaaagccacttgccgctgtgcataatgaaacagatcgtcgctccttt
tcagagccactgcaagacgttattacttatgatcaaagtaatcaaggccgtttcgacaat
gatacagaatatagtgattcagaagaagaggcggctcctccgttaaaaagaagattgatt
gaaaatgaagaatacggcccaacacaggttgaaaaagccaaatccatattttag

DBGET integrated database retrieval system