Leopardus geoffroyi (Geoffroy's cat): 123580244 Help Entry 123580244         CDS       T10761                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf04080   Neuroactive ligand-receptor interaction lgf04081   Hormone signaling lgf04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     123580244 (GHRH)    04081 Hormone signaling     123580244 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     123580244 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lgf04052]     123580244 (GHRH) Cytokines and neuropeptides [BR:lgf04052]  Neuropeptides   GPCR binding    123580244 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  123580244 NCBI-ProteinID:  XP_045300608 LinkDB All DBs Position A3:22290197..22303470 Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVILTLDSGSHCSPPPLPLRMPRYADAVFTNSYRKVLGQLSARKLLQDIMSRQ QGERNQEQGAKVRLGRQVDSVWAGQKQMALESILVALLQKHRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtgatcctcaccctcgacagtggctcccactgctcc ccgccacccctgcccctcagaatgcctcggtatgcagatgccgtcttcaccaacagctac cggaaggtgctgggtcagctgtctgcccgcaagctactgcaggacatcatgagcaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacagc gtgtgggcaggtcaaaagcagatggcgttggagagcatcctggtggccctgctgcagaag cacaggaattcccaaggatga

DBGET integrated database retrieval system