Lottia gigantea (owl limpet): LOTGIDRAFT_101115 Help Entry LOTGIDRAFT_101115 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K11251   histone H2A Organism lgi  Lottia gigantea (owl limpet) Pathway lgi03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:lgi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     LOTGIDRAFT_101115  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lgi03036]     LOTGIDRAFT_101115   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgi04147]     LOTGIDRAFT_101115 Chromosome and associated proteins [BR:lgi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     LOTGIDRAFT_101115 Exosome [BR:lgi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LOTGIDRAFT_101115 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C Motif Other DBs NCBI-GeneID:  20229540 NCBI-ProteinID:  XP_009048981 JGI:  101115 UniProt:  V4B254 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search GNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKL LSGVTIA NT seq 202 nt NT seq  +upstreamnt  +downstreamnt ggaaactatgccgagcgagtcggagctggtgccccagtctacttagccgctgttttggaa tatttggctgctgaagttctcgagttggctggtaacgctgcccgtgacaacaagaaatcc agaatcattccaagacatttacagttggctatccgaaatgacgaggaattgaacaagctg ttgtccggagtaaccatcgctc

DBGET integrated database retrieval system