KEGG   Leptospira interrogans serovar Copenhageni: LIC_10459
Entry
LIC_10459         CDS       T00166                                 
Symbol
add
Name
(GenBank) adenosine deaminase
  KO
K21589  cAMP deaminase [EC:3.5.4.46]
Organism
lic  Leptospira interrogans serovar Copenhageni
Brite
KEGG Orthology (KO) [BR:lic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LIC_10459 (add)
Enzymes [BR:lic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.46  cAMP deaminase
     LIC_10459 (add)
SSDB
Motif
Pfam: A_deaminase AMP_deaminase Mst1_SARAH
Other DBs
NCBI-ProteinID: AAS69080
UniProt: Q72V44
LinkDB
Position
I:523243..524571
AA seq 442 aa
MALTFQEILDRIRIIDRDVTELNRLKSRLPADRPYSSSLQISFDKQINELLNERVGLMEL
EVLDPPSWILGVPTTGISQETPVPLKGLFPSGDLSKEKPDDQDVINFLRELPKTEIHLHL
EACVNKDTMKRLMAKNGINVTDEEFEAKFNFKDLNSFIQVFFFIQSLVKEPSDFSFFIES
LAEYMRANNILYTEVFFAPSKFIQNGLDFEEMIDFLVNRIREEKENDGIVIRLLVDVSRS
FGPENAMKNLDRVLKLRHPEVIGIGLGGAELMGPARDYQGVFQKAREAGLRVVAHSGEDD
GPWAIWEAVELLKAERIGHGTSAIQDPELVKYLRENHIPIEICVTSNVFTGKYVRKEQNH
PVRYYYDQGLPLSINTDDPEIFNVNLTYEYYKLWRFLDFSLDEIVDLIRQGVFASFHPNK
ESLWAEMEKNIHLVKTRYGLKR
NT seq 1329 nt   +upstreamnt  +downstreamnt
gtggctttaacttttcaagagattttagatagaattcggatcatcgatcgagacgtgacc
gaactgaaccgtttgaagtctagacttcctgcggaccgaccttattcttcttctttacaa
atttcttttgataaacaaatcaacgaactcttaaacgaaagagtcggtctcatggaactt
gaggtcctagatccgccttcttggatcttaggagttcctacaactgggatttctcaggaa
actccggttccactcaaaggcctttttccgtccggagatctttctaaggaaaaaccggac
gatcaagacgtaattaatttcctacgagaacttcctaaaacggaaattcatctccacctt
gaggcgtgtgttaataaggacacgatgaaaagattgatggctaaaaatggaattaatgta
acggatgaagagtttgaagctaaattcaattttaaggatttaaacagtttcattcaggta
ttcttttttattcagtcgcttgttaaagaaccttctgatttctcattttttatagaaagt
ctcgcggaatacatgagagcgaataacatcctttatacggaagttttttttgcaccttct
aagtttattcagaacggtctcgattttgaagaaatgatcgattttttagtcaatcgaatt
cgagaagaaaaagaaaacgacggtatcgtcatacgtctattagttgatgtttccagatcc
tttgggccagaaaatgcgatgaaaaatctagatcgggttctaaaactgagacatccggaa
gtgattggaattggtcttggaggcgcggaacttatgggacccgccagggattatcaaggg
gtttttcaaaaagcgagggaagcggggctcagagtggtggcgcattccggagaagacgat
ggtccttgggcaatttgggaggcggtggaacttctcaaagcggagaggattggacacgga
acttctgcgatccaagatcccgagttagtaaaatatcttagggagaatcatattccaatc
gagatttgtgtgacgtctaacgtatttactggtaaatacgttagaaaagaacaaaaccat
ccagttcgttattattacgatcagggtcttcctcttagtatcaatacggacgatcctgag
atattcaatgtaaatcttacatacgaatattataaactttggagattcttagatttctct
ttggatgagatcgtagatttgatccgtcaaggtgtttttgcttccttccatcccaataaa
gaatctctctgggccgaaatggaaaaaaacattcatctcgtaaaaacaagatacggtcta
aaaagataa

DBGET integrated database retrieval system