KEGG   Lactobacillus johnsonii NCC 533: LJ_0182
Entry
LJ_0182           CDS       T00158                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0182
   00500 Starch and sucrose metabolism
    LJ_0182
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LJ_0182
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: AAS08164
UniProt: Q74LK3
LinkDB
Position
complement(214451..215899)
AA seq 482 aa
MTGYTMPKGFLWGGAVAAHQLEGAWDEDGKGMSVADVMTVGSATKPREITDGVIPGKNYP
NHEAIDFYHHYKGDIKLMAEMGFKAFRTSIAWTRIFPKGDEEEPNEAGLKFYDDLFDECH
KYGIEPVITLSHFEIPYHLVKEYGGFTNRKLIDYFVRFARVCFKRYKNKVKYWMTFNEID
NQSSFNNDFLMATNSGILFKNGMGDKEKEAAMYQAAHYELVASALAVKEGHKINPDFQIG
CMINYSPVRPLTPSSDDVLLADKFEQRRDFFSDVHVNGEYPNAVEDYIERNGYRPDITEE
DKIALKEGTVDYVGFSYYQSTTVSSKKVKPDELTDLQEAIVENPTLERSDWGWEIDPEGL
RISLNHLTDRYHKPLFIVENGLGAYDKREADGSVHDPYRIDYLRKHIEQMEKAVVLDGVD
LMGYLPWGCIDLVSAGTGQMDKRYGFIYVDKNDKGDGTLERSKKDSFNWYKKVIESNGKD
LD
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgactggatacactatgcctaagggctttttatggggcggcgctgttgctgctcaccaa
cttgaaggtgcatgggatgaagatggaaagggaatgtctgtagcggatgttatgacagta
ggatcagccactaagccgcgtgaaattactgatggcgttattcctggtaaaaactatcct
aatcatgaggccattgatttttaccatcactacaagggtgatattaagttaatggctgaa
atgggctttaaagcttttcgtacttcaatagcttggactagaatttttcctaaaggcgat
gaagaagaacctaatgaagcaggtcttaagttctacgatgacttatttgatgaatgtcat
aagtatggaattgaacctgtaattaccctttctcactttgaaattccttatcacttagtc
aaagaatatggtggttttactaaccgtaaattaattgattactttgttcgctttgcccgt
gtttgctttaagcgttacaagaataaagttaaatactggatgactttcaacgaaattgat
aatcaatctagttttaacaatgacttcttaatggctactaactctggtatcttgtttaag
aacggaatgggcgataaagaaaaagaagctgctatgtatcaagcagcccactatgaatta
gttgcttctgctttagcagttaaagaaggccacaagattaatccagactttcaaattggt
tgtatgattaattactcacctgttcgtcctctaactccatcatcagatgatgttttactt
gctgataagtttgaacaaagacgtgacttcttctctgatgtccacgttaatggtgaatat
ccaaatgctgttgaagattacattgaaagaaatggctaccgtccagatatcactgaagaa
gataaaattgccttaaaagaaggtacagtagactacgttggcttctcatactatcaatcc
actactgtttcaagtaagaaagttaaaccagatgaattaactgacttacaagaagcgatc
gtagaaaaccctactttagagcgtagtgactggggttgggaaattgatccagaaggtttg
agaatctctcttaaccacctaactgaccgctaccacaagccactatttatcgttgaaaat
ggtctcggtgcttacgacaaacgtgaagctgacgggtcagttcatgatccatatcgaatc
gattacttgagaaaacacattgaacaaatggaaaaggccgttgtgttagatggtgttgac
ttgatgggttatcttccttggggatgcatagacttagtttcagctggaacgggtcaaatg
gacaagcgttatggcttcatctatgttgacaagaatgacaagggtgacggaacgctagaa
cgctcaaagaaggattcatttaactggtataagaaagttattgaatctaacggtaaagat
ttagactaa

KEGG   Lactobacillus johnsonii NCC 533: LJ_0188
Entry
LJ_0188           CDS       T00158                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0188
   00500 Starch and sucrose metabolism
    LJ_0188
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LJ_0188
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: AAS08170
UniProt: Q74LJ7
LinkDB
Position
complement(220742..222235)
AA seq 497 aa
MTKNYSMPKDFYWGGASAANQYEGGYKDGGKGLNAVDVLTNGSANEPRKVTWKTADGKTG
STPMVWGKEFKLPEGAKPAPLADYYYPSHEGTDFYHHYKEDIKYMADMGFNMFRLSLNWS
RILPNGDDKEPNKEGLAFYDKVFDECAKYGIEPLVTLSHYETPLSLVNRFGGWKDRKMID
IFVHYADIVMNHYKGKVKYWLTFNEINAMDMAPYMGGGLIDGSEQNRAQGAHNQFVASSK
VVKLAHEIDQNNQVGQMLAYSAYYPYTADPADQILVMKAKQEMLFYSDVQTGGRYPEYRL
KQYERDGIKLDDKPEDYELIENYPADFLSFSCYTSNVLTTHEADAKANGNVSAGGVKNPY
LDYNAWGWATDPDVLRIALNDLWDRYHKPLFIVENGLGWGDELTEDHKVHDDYRIDYLRA
QIKSMEEAVNEDGIPLMGYTMWSAIDLVSNGTGEMKKRYGFVYVDRDDKGNGSLKRYPKD
SFNWYKKVIVSHGKDLD
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacaaaaaactactctatgcctaaagacttttactggggcggtgctagtgctgcaaac
cagtatgaaggtggttataaagacggtggaaaaggattaaacgccgttgatgtactaact
aatggttctgctaatgaaccaagaaaagtcacctggaaaactgctgatggcaaaactgga
tctactccaatggtttggggaaaagagtttaaactacccgaaggagcaaaaccagctcct
ttagctgactattactatccaagccatgagggaacagacttctatcaccactataaagaa
gatattaaatatatggctgacatgggctttaatatgttccgtctatcattaaattggtca
cgtatcttaccaaacggcgatgataaagaaccaaataaagaaggcttagccttctatgat
aaggtctttgatgaatgtgctaaatatggcatcgagcctttagtaactctctcccactat
gaaactcccttatctttagttaatcgttttggaggctggaaagaccgaaaaatgattgac
atttttgttcattatgctgatattgtaatgaatcactacaaaggaaaagttaaatactgg
ctaacctttaacgaaattaatgctatggacatggctccttatatgggcggcggattaatt
gatggtagtgaacaaaatcgtgctcaaggagctcataatcagtttgtagcaagcagtaaa
gtagttaagctagctcatgaaatcgatcaaaacaatcaagtaggtcaaatgcttgcctac
tctgcttactatccttatactgctgacccagctgatcaaattttagttatgaaagctaaa
caagagatgctcttttactcagatgttcaaactggaggtcgttaccctgaatatcgttta
aaacaatatgaacgtgatggcatcaaacttgatgataagccagaagactatgagttaata
gaaaattatccagcagactttctaagcttttcttgctacacttctaatgttcttactaca
catgaagcagacgcaaaagctaatggtaatgtttccgcaggtggcgttaagaacccttat
cttgactacaacgcttggggatgggcaacggacccagatgtattacgaattgccttaaat
gacctttgggatcgataccataagcccctctttatcgttgaaaatggtcttggttggggc
gatgaattaactgaagatcataaagttcatgatgactatcgaattgactatcttcgtgcc
caaatcaaatcaatggaagaagcagttaatgaagatggtattcctttgatgggttatacc
atgtggtcagcaatagacttagtctcaaatggtactggtgaaatgaaaaaacgctatggc
tttgtttatgttgatcgtgatgacaaaggaaatggatctttaaagagatatcctaaggat
tcctttaactggtataaaaaagttattgtctcccatggaaaagatttagactaa

KEGG   Lactobacillus johnsonii NCC 533: LJ_0194
Entry
LJ_0194           CDS       T00158                                 

Definition
(GenBank) beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0194
   00500 Starch and sucrose metabolism
    LJ_0194
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LJ_0194
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: AAS08176
UniProt: Q74LJ1
LinkDB
Position
complement(225600..226979)
AA seq 459 aa
MNKHKMPKDFFWGNSVSSMQTEGAWDEDGKGLSVYDVRPATENTTDWHTAIDEYHRYDED
LDLMKEMNMNMYRIQISWSRVCPEGDGDFNPKGIEFYDKLVDAMLDRGIEPMICLYHFDM
PLHLAKEYNGFMSRHVVDAFVRFGKKMIDHFSDRVKYWIVFNEHNLYFQDEVFNISGYEK
GDKTLDDMYTIFHHTMISHIRLANYIHEKYDDVKIGGMLAFQQIYPETSKSTDVWAAKQI
QEFLNFNIYDADTGRGYSPEVLQYAKNHNINLDITKEDKEEMKKAKADFLAFSYYSSWTV
SADKIPADVAPNRYMNYGGVENKYLKTNAWGWTIDPLGFRNAITTMYNHYKIPVFPIENG
IGLKETWDSEHMIEDDERIAYHEEHIKAMKDAMFLDGAKVLGYLGWGLIDIPSSHADMEK
RYGAVYVNRSNHDLKDLKRVPKKSFYWFQKVLKDNGDEI
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaataagcacaaaatgcctaaagacttcttctggggcaattcggtttcaagtatgcaa
actgaaggtgcctgggatgaagacggtaaaggcttatcagtttacgatgtacgacctgct
acagaaaatactacagactggcacaccgcgattgatgaataccatcgttatgatgaggat
ttagacctaatgaaagaaatgaatatgaatatgtatcgtattcaaatttcatggtcaaga
gtttgtcccgaaggagacggggattttaatcctaaaggaattgaattttatgacaaatta
gtagatgccatgcttgatcgcggaatcgagccaatgatttgtctttatcactttgacatg
cccctacacctagcaaaagaatacaacggttttatgtcacgccatgttgttgatgctttt
gttagattcggcaaaaagatgattgatcatttttcagaccgagttaaatactggattgtt
ttcaatgaacataatctttacttccaagacgaagtatttaacatctctggttacgaaaaa
ggtgacaaaactttagatgatatgtataccatctttcaccacaccatgatcagtcatatt
cgattggctaattacatccatgaaaaatatgatgatgtaaaaatcggcggaatgcttgcc
ttccaacaaatttatcctgaaacttcaaaatctaccgatgtttgggcagcaaaacaaatt
caagaatttttgaatttcaatatttatgatgcagatactggccgcggttattcaccggaa
gtactgcaatatgctaaaaaccacaacattaatttggatataactaaagaggataaagaa
gaaatgaaaaaagcaaaggctgactttttagcttttagttactattcttcttggacagtg
tcagctgataaaattcctgccgacgttgctcctaaccgttacatgaattatggcggtgta
gaaaacaagtatctcaagacaaatgcttggggctggacaattgatccacttggttttaga
aacgctattaccactatgtacaaccattacaagattccagtcttcccaattgaaaacgga
atcggcttaaaagaaacttgggatagtgagcatatgatcgaagatgatgaacgtattgct
taccatgaggaacatattaaggctatgaaggatgccatgttcttagatggagctaaagtt
ttaggttatctaggttggggattaatcgatattccaagttcacatgccgatatggaaaag
cgttacggtgctgtttatgtcaaccgttcaaatcatgacttaaaagatttaaaacgtgtt
ccaaagaaatcattttattggttccaaaaagtattaaaagataatggagacgaaatataa

KEGG   Lactobacillus johnsonii NCC 533: LJ_0544
Entry
LJ_0544           CDS       T00158                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0544
   00500 Starch and sucrose metabolism
    LJ_0544
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LJ_0544
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: AAS09677
UniProt: Q74HL3
LinkDB
Position
complement(1835953..1837431)
AA seq 492 aa
MKYYHVPEGFKWGVATAANQIEGAWNEDGKGISIADCERYDPEKARAGYKSANSMTSSEI
KRAMADKDSKRWGKRHGVDFYHQYPEDIKKLAATGINTFRTSIAWSRIFPNGDDIKPNEK
GLEFYDKLFDELHRYNIEPIVTLSHYEMPLNLVLNYDAWYDLRVREFFIKFAKIVIDRFH
GKVKYWIPINEIDSILRHPFSSAGLIRDRFLNENFEKVIYQAMHNQFVAAAAITKYIHET
YSDIQVGSMITSTMIYPYNSDPRNSLKSVQLMRESYNFSDIQIRGKYPLNLVPKLKNLHI
KISKEDLDLISENTADFIAFSYYSSVCTAFDTKGLKVTKANRMEGVYNKYLPTSDWGWQI
DPIGLRIILINLYDRYQKPLFIVENGLGAKDSLTTSGKIHDDYRIDYLRQHIKQMLVSIQ
NDGIELMGYCMWGMTDMVSASTTQISKRYGLIYVDLDDFGDGTYKRYLKDSYFWYQKLLS
FKNKIPKDFLDK
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaaatactatcacgtgcctgaaggatttaagtggggtgtcgcaacggctgctaatcag
atagaaggagcttggaatgaagatggtaaaggaatttcaattgctgattgcgaacgctat
gatcctgaaaaagcgagagcaggctataagtcagcaaatagtatgacaagttctgaaatt
aaacgtgctatggcagataaagatagtaaacgttggggaaaaaggcatggagtagatttt
tatcatcaatatcctgaggatataaaaaaattagcggctacgggaattaatacttttaga
acttctattgcatggagtagaatttttccaaatggtgatgatattaagcctaatgaaaag
ggactagaattttatgataagttatttgatgagctacatagatataatattgaaccaata
gttactctatctcattatgagatgcccttaaatttagtattaaactacgatgcttggtat
gatttgcgcgttagagagttttttataaagtttgcaaaaattgtgatagatcgttttcac
ggcaaagttaaatattggattccgattaatgaaatagatagtattttgcgtcatccattt
tcttcagctggattaataagagatcgctttctaaatgaaaattttgaaaaggtcatctat
caagcaatgcacaatcagtttgtagcagctgctgcaataacaaaatacattcatgaaact
tattctgatatacaggtaggttcaatgattacaagtacaatgatctatccttataatagt
gatccacgcaacagccttaagagcgttcagttaatgcgagaaagctataattttagtgat
attcaaattcgtggtaaatatcctctaaatttagtgccaaaattaaagaatttacatatt
aaaatatcaaaggaagacttagacttaattagtgaaaatacagcagattttattgcattt
tcatattactcttctgtttgcactgcttttgatacaaaaggattaaaagtaacaaaagca
aatcgtatggaaggggtttataacaaatatttacctaccagcgattggggatggcaaatt
gatcctattggtctaaggattatattaattaatttatacgatagatatcaaaagccccta
tttattgttgaaaatggattaggtgctaaggatagtctgactacaagtggaaaaattcac
gatgattatagaattgattatttacgacaacatattaaacagatgttagtctctatacaa
aacgatggaatagagcttatgggctattgtatgtggggaatgactgatatggtatcagca
tcgacaacacaaatttctaagcgatacggtttaatatatgttgatttagatgattttgga
gatggaacttataaacgatacttgaaagattcatatttttggtatcagaaacttttatct
tttaaaaataaaattcccaaagattttttagacaaataa

KEGG   Lactobacillus johnsonii NCC 533: LJ_0736
Entry
LJ_0736           CDS       T00158                                 

Definition
(GenBank) beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0736
   00500 Starch and sucrose metabolism
    LJ_0736
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LJ_0736
SSDB
Motif
Pfam: Glyco_hydro_1 Glyco_hydro_10
Other DBs
NCBI-ProteinID: AAS08554
UniProt: Q74KL6
LinkDB
Position
628828..630321
AA seq 497 aa
MYHKQLDEFPTDFLWGASSAAYQIEGGAKEDGKGLSIWDKYAHQAGNTFKGTNGDVAVDH
YHRYKEDVELMAKQGLKAYRFSVSWSRILPAGEGKVNQAGINFYRDLINELRKNKIEPIL
TIYHWDLPLALQEKYGGWESRKTIEAFVNYAKILFSEFGEKVKYWITINEQNVFTSMGYR
WGTHPPKKQNIKTMFQANHYINLANALAITEFHKMVPAGKIGPSFGYGPVYPKTNSPEDV
LAALNADDFNNNWWLDVYCRGKYPFFIRKQLENLNLMLEITKKDKAILENDAAHPDFLGI
NYYHGGTVQENRLQKPATNDKEKQFNKVDPYLMQPKGDQAKNPEVPMFNGVENDYVNKTN
WGWEIDPTGLRIALRQVYEKYQLPIMITENGLGAKDIVENGKINDQYRIDYLADHVLAMK
EAISDGVDLIGYCAWSFTDLLSWLNGYSKRYGFVYIDQNDEQKGTLKRIPKKSYTWYKSI
IATNGNDLSLLKHGEQK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgtatcataaacaattagacgaatttcctacagattttttgtggggagcaagttctgca
gcttatcaaatcgaaggtggagctaaagaagatggcaaaggattatccatttgggataaa
tatgcacaccaagcgggtaatacctttaaaggaaccaacggggatgttgcagttgatcac
tatcatcgttataaagaagacgttgaattaatggctaagcagggattaaaagcatatcgt
ttttctgtttcttggagtagaattttgccagctggtgaaggtaaagttaaccaagcggga
ataaacttttatcgtgatttaattaatgagttacgtaaaaataagatagaaccaattctt
acaatctaccattgggatttaccgttagcactccaagaaaaatacggtggatgggaatct
agaaagacaattgaagcatttgttaattatgcaaaaattctcttttcagaatttggagag
aaagttaagtattggataactataaatgaacaaaatgtattcacgtcaatgggctatcga
tggggaacacacccaccgaagaaacagaatatcaagacaatgtttcaagcaaatcactat
attaatttagcgaatgcactagcaattactgaatttcataagatggttccagctggaaaa
attggaccaagttttggttatggcccagtttaccccaaaactaatagtcccgaagatgtc
ttagccgccttaaatgctgatgattttaataataactggtggttagatgtttattgtcgt
ggaaagtatccattctttataagaaaacaactagaaaatttgaatttaatgcttgagatc
actaaaaaagataaggctattttagagaatgatgcggcacatcctgactttttaggtata
aattattatcatggaggaacggttcaagagaatcgattacaaaaaccggcaactaatgat
aaagaaaaacaatttaataaagtagacccatatttgatgcaacctaaaggggatcaagct
aaaaatcctgaagttccaatgtttaatggtgtagaaaatgattatgttaataaaacaaat
tggggatgggaaattgatccaaccggtttgcggattgctctaagacaagtatatgaaaaa
tatcaactaccgatcatgatcaccgaaaatggactcggtgcaaaagatattgttgagaat
ggaaaaattaatgaccaataccgaattgattacttagcagatcatgttttggcaatgaaa
gaagcaattagtgacggagttgatttaattgggtattgtgcctggtcatttactgactta
cttagttggttaaatggatattcaaagcgttatggctttgtctacattgaccaaaatgat
gagcaaaaaggtactttaaagagaataccgaaaaagagttatacctggtacaagagtatt
atagcgactaatggaaatgatcttagcttgttgaagcatggagaacaaaaatga

DBGET integrated database retrieval system