KEGG   Lactobacillus johnsonii NCC 533: LJ_0511
Entry
LJ_0511           CDS       T00158                                 

Definition
(GenBank) aspartate-ammonia ligase
  KO
K01914  aspartate--ammonia ligase [EC:6.3.1.1]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00250  Alanine, aspartate and glutamate metabolism
ljo00460  Cyanoamino acid metabolism
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
ljo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ_0511
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    LJ_0511
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.1  aspartate---ammonia ligase
     LJ_0511
SSDB
Motif
Pfam: AsnA tRNA-synt_2
Other DBs
NCBI-ProteinID: AAS09710
UniProt: P61190
LinkDB
Position
1869563..1870573
AA seq 336 aa
MTLILPKDYHPSLTIRDTEAAIVFIRENFQDKIADKLNLQRMSAPMFVEKSTGLNDNLNG
IERPVAFDMKAMPDDTIEVVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRRDEDLDNFHS
IYVDQWDWEKIIAKEERNIETLKTTVKQIFKAIKETEKELSARYPGSTYRLPSDITFITT
QELEDRWPDLAPEEREDKIAKEKKAVFLMKIGDKLKRSGKPHDGRAPDYDDWELNGDLLF
WYEPLKRKIEISSMGIRVSEESLKEQLKKAHTEERSDLPFHKMLLEGKLPYTIGGGIGQS
RLCMLLLGKAHIGEVQASIWPPEMIESCKAADIKIL
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgacattaatattacctaaggactaccatccaagtttaaccattcgtgatactgaagcc
gcaattgttttcattagagaaaattttcaagataaaattgctgacaaattaaaccttcaa
agaatgtcagcaccaatgtttgttgaaaaatctactggattaaatgataacttaaatggg
attgaacgtccggttgcttttgatatgaaggctatgccagatgatacaatcgaagttgta
cactcattagcaaaatggaaacgtctagcacttaagcgttatggttttggaatgcatgaa
ggtctttatactaacatgaacgcaattcggcgtgatgaagatttagataattttcactca
atctacgtagatcaatgggactgggaaaagattattgctaaagaagaaagaaatattgag
actcttaaaactactgtcaaacaaatttttaaagcaattaaagaaactgaaaaagagctc
agcgcacgctatccgggttctacttaccgcttacctagcgatattacttttattactaca
caagaactggaagaccgctggccagatttagcaccagaagaacgtgaagataaaatagct
aaagagaaaaaagcagtattcttaatgaaaattggtgataaattaaagcgtagtggtaag
ccacatgatggccgtgcaccagattacgatgactgggaattaaacggtgacttactattt
tggtatgaacctttaaaacgtaaaatagaaatttcttcaatgggaattcgagttagcgaa
gaatcgctgaaagagcaactcaaaaaagctcatactgaagaaagatctgatttacctttc
cacaaaatgcttttagaaggtaaacttccttatacaattggtgggggtattggccaatct
cgtttatgtatgcttttgcttggaaaagctcatattggcgaagtccaagcaagtatttgg
cctcccgaaatgattgaatcatgtaaagctgccgacataaaaattctatag

DBGET integrated database retrieval system