KEGG   Lactobacillus johnsonii NCC 533: LJ_0514
Entry
LJ_0514           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0514
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     LJ_0514
SSDB
Motif
Pfam: GATase_3 GATase Peptidase_C26
Other DBs
NCBI-ProteinID: AAS09707
UniProt: Q74HI3
LinkDB
Position
1866150..1866833
AA seq 227 aa
MADKTIKIAYLYEDLMNTYGDSGDVKVIRYLLDKQGYQTEVDNISLDDSFDANDYDFLFF
GGGQDFEQTVVAKDLPRHKETIENYIKAGNPMLCICGGYQLMGDYYKTNSGITIKGLGIL
PLHTIFKADKRMIGDTRYMTEWGEVKAFENHSGQTYFDNTNMLHPFGEMIEGYGNNPQDK
VEGLRYKNFIGSYSHGPLLRNTNVANAIVKMILERHKERTANEVESV
NT seq 684 nt   +upstreamnt  +downstreamnt
atggcagataaaacaataaaaattgcatacttatacgaagatttaatgaatacttacgga
gattctggcgatgttaaagtaattcgttacctattggataagcaaggctatcaaactgaa
gttgataacatttcattagacgatagttttgatgctaatgactacgactttttattcttt
ggtggtggtcaagactttgaacaaactgttgtagctaaagatctgccacgtcataaagaa
acaattgaaaactatatcaaagccggtaatccaatgctttgtatctgtggtggttatcaa
ttgatgggagattattataaaactaactctggcattaccatcaaaggattagggatctta
cctttacatacaatttttaaggcagacaagcgaatgattggtgatacccgctatatgact
gaatggggcgaagtaaaagcctttgaaaatcattcaggacaaacttactttgataatact
aatatgcttcatccctttggtgaaatgattgaaggttacggcaacaatccccaagataaa
gttgaaggtttacgctacaaaaactttattggatcatattcacacggaccgctacttcga
aacacaaatgtggcaaacgcgattgttaaaatgattttagaacgtcacaaggagcgtact
gctaatgaagttgaatccgtttag

KEGG   Lactobacillus johnsonii NCC 533: LJ_0928
Entry
LJ_0928           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0928
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     LJ_0928
SSDB
Motif
Pfam: MurT_C Mur_ligase_M YpsA A2L_zn_ribbon DZR zinc_ribbon_2
Other DBs
NCBI-ProteinID: AAS08749
UniProt: Q74K27
LinkDB
Position
complement(829568..830920)
AA seq 450 aa
MNLKSGIAKVAGKSSYWFLHNVLKGGTSFPGKFAMKIDPEVLNSLAKGYETIIVTGTNGK
TMTTALIVEALKKKYGDILTNPSGSNMQQGIVTAFLAHKNKRAKKKIAVLEVDEANVKMV
TKLLHPSVFVLTNIFRDQMDRYGEIYTTYQKIVDGIKLAPDATIIANGDASIFSSVELPN
KKVFYGFKLPEDKPENDFKAPVNTDGVLCPKCDHILHYHERIYANLGDYFCPNCGYHRPE
LTYSVNQIIDQTPNSLKFKMGEKEYSIGIGGTYNIYNALAAYSVAREFGLSEEEVAQSFA
ENKRIFGRQELINYADKEIDLILVKNPVGLDEVLHMLNTEKDNYSLVTLLNANHADGIDT
SWIWDADYEGLNKDQIKKVIVGGKRWHDMGFRLEVSGFEPGLMTTATNNEALLDEISKLP
TKKVYILATYTAMLSLRKTMGEKKIIKAGM
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaatttaaaatcaggcatcgctaaggtagctggtaaatcatcttactggtttcttcat
aacgtattaaagggcgggacgagttttcctgggaaatttgccatgaaaattgatcctgaa
gtattaaattcattagcaaaaggctatgagacaatcattgttactggaactaatggtaaa
acaatgacaaccgctttaatcgtggaagcattaaagaagaaatatggtgatattttaact
aatccatcaggctcaaatatgcaacaaggaattgttacagcatttttagctcacaagaat
aaaagagcaaaaaagaaaattgctgtgctagaagtagatgaagcaaatgtaaaaatggta
accaagttactacatccaagcgtatttgttttaactaatattttccgtgatcagatggat
agatacggtgaaatttatactacctaccaaaagattgtcgacggaattaaactagctccc
gatgcaactattatcgctaacggagatgcaagtattttttcatccgtggaattacctaat
aaaaaagtattctatggcttcaaacttccggaggacaagcctgaaaatgacttcaaggct
cccgtaaatactgatggtgttttatgtcctaagtgcgatcatatcttgcattatcacgaa
cgtatttatgcaaacttaggagactatttctgtcctaattgtggctaccatcgtccagaa
ttaacctatagtgtaaatcaaattattgatcaaactccaaatagcttaaaattcaaaatg
ggtgaaaaagagtacagcattggtatcggtggtacctataatatctataatgctctagct
gcttattctgtagcgcgtgaatttggtttaagtgaagaagaagtagcccaaagttttgct
gaaaacaaacgaatttttggtcgccaagaattgattaattatgcagataaggaaatagat
ctcatcttagttaaaaatccagttgggcttgatgaggttctccatatgttaaatactgaa
aaagataactattctttagttactcttttaaatgcaaatcacgcagacggaatcgataca
tcctggatctgggatgcagactatgaaggtttaaacaaagatcaaatcaaaaaagtaata
gtcggtggaaaacgttggcatgatatgggattcagactggaagtttcaggttttgagccg
gggttaatgacaactgctactaataacgaagctttgctagatgaaatttcaaaattacca
actaagaaagtttatattttagccacttatactgctatgctttcacttcgtaaaacaatg
ggtgaaaagaaaattattaaagcaggtatgtaa

DBGET integrated database retrieval system