KEGG   Lactobacillus johnsonii NCC 533: LJ_0687
Entry
LJ_0687           CDS       T00158                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00030  Pentose phosphate pathway
ljo00051  Fructose and mannose metabolism
ljo00680  Methane metabolism
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
ljo01120  Microbial metabolism in diverse environments
ljo01200  Carbon metabolism
ljo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0687
   00030 Pentose phosphate pathway
    LJ_0687
   00051 Fructose and mannose metabolism
    LJ_0687
  09102 Energy metabolism
   00680 Methane metabolism
    LJ_0687
Enzymes [BR:ljo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LJ_0687
SSDB
Motif
Pfam: F_bP_aldolase BKACE
Other DBs
NCBI-ProteinID: AAS08505
UniProt: Q74KR4
LinkDB
Position
577921..578838
AA seq 305 aa
MAYLVNGNDIFKAARENHYAVGAYNTNNLEWTRALLRGAKETRTPLLIQVSTGAAKYMGG
YKTVKDLVLNEMDNMDIDVPVILNLDHGDFESAKECIALGYSSVMFDGHNLPTDENLAKT
KEIVKLAHERGISVEAEIGKIGENQGADGGELASVEDAKTFVAAGVDKLACGIGNIHGVY
PEGWTGLNFDRLKEIAEAVPNEPLVLHGGSGIPQDQIEKAIQLGIAKININTEFQLAFQA
ATRKYIEDKMDLDKGNKGYDPRKLLRAGTDAITDSMKEMISWMGTAPIDTKESSVQFDEA
SLNEE
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcttatttagtaaatggtaatgacattttcaaagctgctcgtgaaaaccactacgct
gtaggtgcatacaacactaacaaccttgaatggactcgcgcacttttaagaggtgctaag
gaaactagaactcctttattgattcaagtttctactggtgctgctaagtacatgggtggt
tacaagactgttaaggacttagttcttaacgaaatggacaacatggatatcgatgttcca
gttattttgaacttggaccacggtgactttgaatcagctaaggaatgtattgcacttggt
tactcatcagttatgtttgatggtcacaacttaccaactgacgaaaacttagcaaagact
aaggaaatcgttaagttagctcacgaaagaggtatctctgttgaagctgaaatcggtaag
attggtgaaaaccaaggtgccgatggtggtgaattagcatcagttgaagacgctaagact
ttcgttgctgctggtgttgacaagcttgcttgtggtattggtaacattcacggtgtttac
ccagaaggttggactggcttaaacttcgatcgtttgaaggaaattgcagaagcagttcca
aacgaaccacttgttcttcacggtggttcaggaattcctcaagaccaaatcgaaaaggca
attcaattaggtattgctaagattaacatcaacactgaattccaattagcattccaagct
gcaactcgtaagtacatcgaagacaagatggacttagacaagggcaacaagggttacgat
ccacgtaagcttttgagagctggtactgacgcaattactgattctatgaaggaaatgatt
tcatggatgggtactgcaccaatcgacacaaaggaatcatcagttcaatttgatgaagct
tcattaaacgaagaataa

DBGET integrated database retrieval system