KEGG   Lactobacillus johnsonii NCC 533: LJ_0872
Entry
LJ_0872           CDS       T00158                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
ljo01120  Microbial metabolism in diverse environments
ljo01200  Carbon metabolism
ljo01230  Biosynthesis of amino acids
Module
ljo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ljo04131]
    LJ_0872
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ljo04147]
    LJ_0872
Enzymes [BR:ljo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     LJ_0872
Membrane trafficking [BR:ljo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LJ_0872
Exosome [BR:ljo04147]
 Exosomal proteins
  Proteins found in most exosomes
   LJ_0872
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N Glyco_tranf_2_5 NLBH NAD_binding_3
Other DBs
NCBI-ProteinID: AAS08693
UniProt: Q74K81
LinkDB
Position
777213..778229
AA seq 338 aa
MTVKIGINGFGRIGRLAFRRIMDLGEKSSDIEVVAINDLTTPALLAHLLKYDSTHGTFNH
EVSATDDSIVVDGKKYRVYAEPQAQNIPWVKNDGVDFVLECTGFYTSKAKSEAHLKAGAK
RVLISAPAGSDLKTIVYGVNDDTLTADDKIVSAGSCTTNSLAPMVNALQKEFGIEVGTMT
TIHAYTSTQMLLDGPVRGGNLRSARAAAINIIPHSTGAAKAIGLVVPELNGKLNGHAQRV
PVPDGSVTELVSILSKDVTADEVNEAVKKYESPSFAYNDHNIVSSDVLGMTAGSIFDPTQ
TMVTTAGDKQLVKTVAWYDNEYSFTCQMVRTLLKFATL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgacagttaaaattggtattaacggtttcggccgtattggtcgtttagcattccgtcgt
attatggatttaggcgaaaagtcttcagatattgaagttgttgcaatcaacgacttgact
actccagcacttttagctcacttacttaagtacgactcaactcatggtactttcaaccac
gaagtttcagcaactgatgactcaatcgtagttgacggtaagaagtaccgtgtttacgct
gaaccacaagcacaaaacattccttgggttaagaacgatggcgttgactttgttcttgaa
tgtactggtttctacactagcaaagctaagtcagaagctcaccttaaggctggtgcaaag
cgtgtattaatttctgcacctgcaggttcagacttgaagaccattgtttacggcgtaaac
gatgatactttgactgctgatgacaagattgtttcagctggttcatgtactactaactca
ttagcaccaatggttaatgctttacaaaaagaattcggcattgaagttggtactatgact
actatccacgcttacacttcaactcaaatgcttttagatggtcctgtacgtggtggtaac
ttacgttctgcacgtgctgcagctatcaacattattcctcactcaactggtgctgctaag
gctattggtcttgttgttccagaattgaacggtaagttgaacggtcacgcacaacgtgtt
ccagttccagatggttctgtaactgaattagtttcaatcttaagcaaggatgtaactgct
gacgaagttaacgaagcagttaagaagtacgaaagtccttcatttgcatacaacgaccac
aacatcgtttctagcgacgttttaggtatgactgctggttcaatctttgacccaactcaa
actatggtaactactgcaggtgacaagcaattagttaagactgttgcttggtacgacaac
gaatactcattcacttgccaaatggttcgtactttattgaaatttgctactctttaa

DBGET integrated database retrieval system