KEGG   Lactobacillus johnsonii NCC 533: LJ_1184
Entry
LJ_1184           CDS       T00158                                 

Definition
(GenBank) carbamoyl-phosphate synthase, pyrimidine-specific, large chain
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00240  Pyrimidine metabolism
ljo00250  Alanine, aspartate and glutamate metabolism
ljo01100  Metabolic pathways
ljo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LJ_1184
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ_1184
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     LJ_1184
SSDB
Motif
Pfam: CPSase_L_D2 MGS CPSase_L_D3 ATP-grasp_3 Waikav_capsid_1
Other DBs
NCBI-ProteinID: AAS09005
UniProt: Q74JC5
LinkDB
Position
complement(1107548..1110712)
AA seq 1054 aa
MPLHNEINKVLVIGAGPSIVGEVTELDILAKQALTAFEESNVQVVLINPNPATVTTDPHP
NVNVYLEPMTLPFVKRIVRMEKPDAIIPAFGGKPALKLTSELLESGILTQMNIELLTINS
LALSLSAPHNFYSFLKANKIAVANQWLLEKEEDLRRVIEHAHFPLLLSKKQHYRPDSMIS
LENLAQLEQYFLDEESDDHFNWKDYRLTEDLSNWEELIFDIVRDNNGNFVFVGNIGSLEP
VGINSSDSLLVTPILTRNNNQIQRLRNCCRKIANCLNLHGALSIHFAVKQSGEDFNFKVL
SIKPRLTQSSLLSYRSGVYSIGYVTAKIALGYNLNEITDPQSGISAAVDPVQDACFVKLP
YWSFTEAGYNHYTLNNKTTSGGQALGIGRNFESAFLKALQSTTGFSNNVKTFKKEYKKSE
KELLQDLSKPNEIHLITLLAAIAKGINYHTLHQLLHIHLVFLQKFNHILILLKKLRNDEL
TADLMLKVKKNGFSNRLIAEITQRDEKSIADLCKKWSIKPSYIEIDGTAGLIHPNIQAVY
SSYGIEDEIIPLSNSKKCLLLGLKPFQVSLTGEFDYMLYHAAKTLKEQGISPVIISNNPE
SVSAAYDVCDRIYFEPITLENILEVAWKENIKEVVTQFSGKQINEYRSSLLEHGLTILGQ
PNLKEILREDHADEVYQAGVNPVPALQCDNEESILAFVKRNGFPALIGGTSNGKKQKSAV
VFDLPALQRYIAENSLEHMNVSKFIEGKKYEVTAISDGKNVTIPGIIEHFEQTGSHASDS
IAVYRPQNLSTNDQRRLRDSAISIATKLNLRGPVNLHFLLANDQIYLLQIKSYSGHNVAF
LTKALKKDITAITMKVLLGSTLSELDLPSDIWPSNDLIHVKMPVFSYLSYSSENTFDSKM
KTSGSVMGRAKHLPTALFKGYEGSDLMISTYGTVFISVKDSEKHNAIKIAARFHQLGFKL
LATEGTANVLAEEGITTGIIEKVQEGSNSLLEKIKQHRINLVINVTSLSDSASHDAIMIK
DAALSTHIPVFSSLQSAQDVLIVLETLAMTTQPL
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgcctttacataatgaaattaataaagttcttgttattggagcggggccaagtattgtt
ggagaagtaacagaacttgatattcttgctaaacaagcgttaacggcttttgaagaaagt
aacgtacaagttgtattgattaatcccaatcctgcaaccgtcacaacagatccgcatcct
aatgtaaatgtatatcttgaaccaatgacgttgccttttgtgaagcgaatcgttcggatg
gagaagccagatgctattattccggcttttgggggcaaaccggctttaaaacttaccagt
gaattattagagtcgggcatcttaacccaaatgaatattgagttactaactattaacagc
ttggcattgagtctatcagctcctcataatttctatagttttcttaaagcaaataagatt
gcggtggccaatcaatggctgttagaaaaagaagaggacttaaggcgagtaattgaacat
gctcattttcctttgcttttatcaaaaaagcagcattatcgccccgatagcatgatctct
ctagaaaatctagctcaattagaacaatacttcttagatgaagaatccgatgaccatttt
aattggaaagattatcgtttaactgaagatttatcgaattgggaagaattaatttttgat
attgttcgggataataatggaaactttgtatttgtaggaaatattggcagtttagaacca
gttggtattaactcttcggattctttattagtgacgccaattttaactagaaataataat
caaattcagcgcttaagaaattgctgtcgaaagattgctaattgtcttaatttacatgga
gctttgagtattcattttgctgttaagcaaagtggggaagactttaattttaaagtatta
agtattaagccccgtttgactcagagtagtttgctttcttatagaagtggcgtatattct
attggatatgtaacggccaaaattgcacttggctataatttaaatgaaattaccgatcca
caatctggaatttctgctgctgttgatcccgtgcaagatgcttgctttgtaaaattacct
tattggtctttcacagaagctggttataatcactacactcttaataataaaaccacttcc
ggaggccaagctctaggaattggtcgtaactttgaaagtgcatttttaaaggctctccag
tcaactactggtttttctaataatgttaagacctttaaaaaggaatataaaaaaagcgaa
aaagaattattgcaagatctatcgaagcctaatgaaatacacctaattacactattagcc
gcgatagcaaagggaattaattaccacactcttcaccagcttttacatattcatttagta
tttttgcagaagtttaatcatattttgattttattaaagaaattacgtaatgatgaactt
acagctgatttaatgctgaaagtaaagaaaaatggtttttctaatcgattaattgctgaa
attacgcagcgagatgaaaaatcaattgctgatttatgtaaaaaatggtcaattaagcct
agctatattgaaattgatggaacagctggattaattcatcctaatattcaagctgtttac
agtagttatggaattgaagatgaaataataccactatctaattcgaaaaaatgccttctt
ttaggattaaaaccatttcaagtatctctaactggagaatttgattatatgctctaccat
gctgccaagaccttaaaagagcaaggaattagtcctgtgattattagtaataatccagaa
agtgtgagtgcagcgtatgatgtatgcgatcgaatttactttgaaccaattactttagaa
aatattcttgaagttgcatggaaagaaaatatcaaagaagtggtaacgcaattttctggc
aaacagattaatgaatatcgcagttcactcttagaacatgggctaacaattttaggtcag
cctaatttgaaggaaattctaagggaagatcatgcagacgaagtatatcaggccggcgtt
aatccagtcccagctcttcaatgcgacaatgaagaaagcattttagcttttgttaaaaga
aatggttttccagctttaattggtggtacaagtaacggtaagaagcaaaaatctgctgtg
gtctttgatttaccagctttacaaagatatattgctgaaaattcattagagcatatgaat
gtttcgaagtttattgaaggtaaaaagtatgaagtgactgctatttctgatggtaaaaat
gttactattcccggaattattgaacactttgaacagaccggctcacatgccagtgactcc
atagctgtctatcgtccacaaaatttatcaactaatgatcagcgtagattacgtgatagt
gcaattagtattgccactaaacttaatttaagaggaccagttaacttacactttttacta
gctaatgatcaaatctatttattacaaattaaaagttactctggacacaatgtagctttt
ctaactaaagcactaaaaaaagatattacagctataacaatgaaagttttgttaggaagt
acattgtctgaattagatcttccaagcgatatttggccatcaaacgacttaattcacgtt
aaaatgcccgtcttttcttatttatcatatagtagtgaaaatacctttgattctaagatg
aagacctctggtagtgtgatgggacgagccaagcatttgccgactgccttgtttaaagga
tatgaaggcagtgatttaatgatttcaacatatggtactgtctttatttcggttaaagat
tctgaaaaacataatgcaattaaaatagctgcacgttttcatcagttaggttttaagctt
ttagcaactgaaggtactgcaaatgtattagctgaagagggaataacaacaggaattatt
gaaaaggttcaagagggaagcaatagcttacttgaaaagataaagcagcatcgaattaat
ctagtaatcaatgtaaccagtttatccgactctgctagtcatgatgcaattatgattaaa
gatgcagctttaagcacacatattcctgttttttctagtttacaatcagcgcaagatgtt
ttaatagtacttgaaactttagcaatgactactcagcctttgtaa

KEGG   Lactobacillus johnsonii NCC 533: LJ_1185
Entry
LJ_1185           CDS       T00158                                 

Definition
(GenBank) carbamoyl-phosphate synthase, pyrimidine-specific, small chain
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00240  Pyrimidine metabolism
ljo00250  Alanine, aspartate and glutamate metabolism
ljo01100  Metabolic pathways
ljo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LJ_1185
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ_1185
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     LJ_1185
SSDB
Motif
Pfam: CPSase_sm_chain GATase
Other DBs
NCBI-ProteinID: AAS09006
UniProt: Q74JC4
LinkDB
Position
complement(1110716..1111771)
AA seq 351 aa
MKRYLILEDGTAFSGHGFGAPITATGELGIQTSNFGYQEAISDPANFGKILAFTTPMIGG
SGINAIDYESIDPSVRGIIANDIAFHISANPTFQDLNDFLKEKRIPAIYGVDTRALVQKL
KNKRVIKASIMDTDDAHAFDQIKALVLPKNKTAQISTTHPYAAPNIGKTVAVIDLGLKHS
LLRSLSLREINSVVLPYNASIYDIINLRADAIVISNGPSGVEEVAPFLKPVFDKFYGKLP
ILGIGLGFLAISNYLDLELLDLIPAYNGSNFPVIEQTNNRIWQTAMNIDQLVVPDSLSLN
LSRKYFDLRSELLAGYSIKKDKVLATAFNPEGSPGNFDAASIYDQFLNMME
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaaaagatatttaattcttgaagacggaactgcattttcgggacacggttttggtgct
cccattactgctacaggggagctcggtattcaaacaagcaattttggatatcaggaagca
atttccgaccctgccaactttggtaagattttggcttttactactccaatgattggtgga
agtggtattaatgcaatcgactatgaatcaattgatccgagtgtacgtggaataattgct
aacgatattgcttttcatatttctgctaatccaacttttcaagatttaaatgattttcta
aaagagaaaagaattccagcaatctacggtgttgatacccgcgctctagttcaaaaattg
aagaataagcgagttattaaagcgtctattatggatacagatgatgcacatgctttcgat
caaatcaaggccctagttttaccaaaaaataaaacggcacaaatatctacaacgcatcct
tatgctgccccaaatattggcaaaactgtggctgtaattgatcttggtttaaagcattca
ctactgcgatccctttctttacgggaaattaatagcgtggttttaccatacaatgcatca
atttacgacattattaatcttcgagctgatgcaattgttatttctaatggaccaagtgga
gtagaagaagttgcaccatttttaaaaccagtatttgataagttttacgggaaattacct
attttaggaattggcttaggctttttagcaattagtaattatttagacctagaactcttg
gacttaattccagcctataatggtagtaattttccagttattgaacaaactaataatcga
atttggcaaactgcaatgaatattgatcaactagtagtacctgatagtttatctttgaat
ctttcacgtaaatattttgatttaagatcggagttattagcaggctacagtatcaaaaaa
gataaagttttagcaactgcctttaatccagaaggctcaccaggtaattttgatgcagcc
agcatttatgatcagtttttgaatatgatggagtag

KEGG   Lactobacillus johnsonii NCC 533: LJ_1276
Entry
LJ_1276           CDS       T00158                                 

Definition
(GenBank) carbamoylphosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00240  Pyrimidine metabolism
ljo00250  Alanine, aspartate and glutamate metabolism
ljo01100  Metabolic pathways
ljo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LJ_1276
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ_1276
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     LJ_1276
SSDB
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS ATP-grasp_3 Dala_Dala_lig_C ATP-grasp ATPgrasp_Ter GARS_A ATP-grasp_4
Other DBs
NCBI-ProteinID: AAS09097
UniProt: Q74J34
LinkDB
Position
complement(1204168..1207356)
AA seq 1062 aa
MPKRTDIHKIMVIGSGPIIIGQAAEFDYSGTQACLALREEGYEVVLVNSNPATIMTDTTI
ADKVYIEPLTVESISRIIRQEYPDAILPTLGGQVGLNMALSLAKTGILDELNIELLGTRL
SSIEQAEDREKFKELCKELGEPVPPSTTVNTVEEALEFGDRIGYPIIVRPAFTMGGTGGG
ICNNHEELAKIAKNGLELSPVTECLIEKSIAGYKEIEFEVMRDHDDNAMIVCCMENFDPV
GIHTGDSIVFSPSQTLSDKEYQMLRDCSLRLIRALKIEGGCNVQLALDPNSFDYDVIEVN
PRVSRSSALASKATGYPIAKMAAKIAIGMTLDEIKNPVTRTTYAEFEPALDYVVCKIPRW
PFDKFSKADRTLSTQMKATGEVMAIGRTAEEAMQKAVRSLEIDEKDLYSETAHHASDEEI
EQKLVKAQDDRLFYLAEAFRRGYSLEDVHELTKINFYFLDIVSHMVEMEKNIQENKDNLE
TLRLAKKYGFSDATIATLWNESIDQVRDLRKKNGIIPVYKMVDTCAAEFESKTPYFYSTY
DGENESHKSGKKSVIVIGSGPIRIGQGVEFDYATVHCVKALQKMGYEAIVINSNPETVST
DFSISDKLYFEPLTLEDVLNVCDLEKPEGVIVQFGGQTSINLAAGLKDHGIKILGTSVKD
LNRAEDRELFDQIIKKLKLNQPKGLTATTHEGVIKAAEELGYPVLVRPSYVLGGKAMEIV
YNKSELEEYLHDHVDIAADHPILVDDYLDGRECDVDAICDGQDVLLPGIMEHIEHAGVHS
GDSMAVYPPQNFTDEVKDKIMDVTRKLALTLNCVGIMNIQFIVRNGEVYVIEVNPRASRT
VPFLSKITGIEMAQVATRVIMGESLAQQGYSDGLAPEPEMISVKAPVFSFSKLADVDSYL
GPEMKSTGEVMGSDHTFAKALYKAFAGAKMQLPENGNVLLTIEDKDKEKILPIAKRFARI
GYRIFATKGTADFLKNNGLHVDLVTKVHESENADDNILNELREGRIDLVINTMGHDIEKN
SDGFIIRQMAIQQNVPLLTALDTADALLTSLENRSFATDALK
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgcctaagagaacagatattcataagattatggtaattggttctggtccaattattatt
ggtcaagctgcagaatttgattattcaggaacacaggcttgcttagctcttcgcgaagag
ggctatgaggtagtattagttaattcaaacccagctacaatcatgactgacactaccatt
gcagacaaggtttatattgaacccctaactgtggaatcaatctcaagaatcattagacaa
gagtatcctgatgcaattttaccaacgcttggtgggcaagttggattaaatatggccctt
tcattagctaaaacaggaattttggatgagttaaatattgaattattaggaacaagactt
tcttcgattgaacaagcagaagatagagagaaatttaaagagttatgtaaagaattgggt
gagcccgttccaccatcaacaactgttaatactgttgaagaagctttagagtttggcgat
agaattggctatccaattatcgttcgtccagcctttactatgggcggaactggtggtggt
atttgtaataatcatgaagagttagcaaaaattgccaagaacggattagaactgtcacct
gttactgaatgtttaattgagaaatcgattgcgggctataaagaaattgaatttgaagta
atgcgtgatcatgatgataatgcaatgattgtgtgttgcatggagaattttgatccagtt
ggaattcacactggggattcgattgttttttcacctagtcagaccttgagtgataaagaa
taccaaatgcttcgtgattgctctttacgtttaattagggctcttaaaattgagggaggt
tgtaatgttcagctagccttagatcctaatagctttgactatgatgtcattgaagtgaat
cctcgagtttcacgatcaagtgcattggcttcaaaagcaaccggttatcctattgcaaaa
atggccgcaaaaattgcaattggtatgacattagatgaaattaaaaatccggtaactaga
acaacatatgctgaatttgaaccagctttagattatgtcgtctgcaaaattcctcgctgg
ccatttgataagttttctaaggccgaccgcactttaagtacccaaatgaaggctacgggt
gaagtaatggcaattggccgaacagctgaagaggcaatgcaaaaagcggtaaggtctctt
gaaattgacgaaaaagatctctattctgaaacagctcatcatgcaagtgatgaagagata
gaacaaaagctagttaaagcacaagatgatcggctcttttatttggcagaagcctttcgc
agaggttatagtcttgaagatgttcatgaattaaccaagatcaacttttatttcttagat
attgttagtcacatggtagagatggagaaaaatatccaagaaaataaagataatcttgaa
actttacgtttagctaagaaatatggttttagtgatgcaaccattgctactttatggaat
gaaagtattgatcaggttagagacttgcgtaaaaagaatgggatcattccagtctacaag
atggttgatacttgcgcagcagagtttgaatcaaagacgccatacttttactcaacttat
gatggtgaaaatgaatcacataagtctggtaaaaaatcagtaattgttattggttctggt
ccaattagaatcggacagggtgtcgagtttgattatgcaactgttcactgtgtaaaagca
cttcaaaagatgggctatgaagcaatcgttattaattcgaacccagaaactgtttcaacg
gacttttcaatttctgataaattatattttgaaccattaaccttagaagatgtattgaat
gtttgtgatttggaaaagcccgaaggtgtaattgtccagtttggaggacagacttcaatt
aatttggctgctgggttgaaagatcacgggattaaaatcttgggaaccagtgttaaagat
cttaaccgtgcagaggatcgtgaactatttgatcaaataattaagaaacttaaattaaat
caaccaaagggcttaactgcaacaacacatgaaggagttattaaagcggctgaagagcta
gggtatccggtcttagttcgtccaagttatgtgctgggtggaaaggcaatggaaattgtt
tacaacaagagtgagcttgaagaatacttgcatgaccacgtagacattgcagctgatcat
ccaattttagtagatgactatttagacggtcgtgagtgtgatgtcgatgcaatttgtgat
gggcaggatgttttactacccggaattatggaacacattgaacatgctggtgttcactct
ggcgattcaatggccgtttacccaccgcaaaactttacggatgaagttaaagataagatt
atggatgttacgcgtaagcttgctcttactttgaattgtgtgggaattatgaacattcaa
tttattgtgagaaatggtgaagtttatgtaattgaagtaaatcctcgtgcaagtagaaca
gttccatttttaagtaagataactggaattgaaatggcacaagttgcgactcgggtaatt
atgggcgaaagcctagcgcagcagggctacagtgatggtctagcacctgaaccagaaatg
attagtgttaaggctcccgtttttagttttagcaagttagctgacgtagactcatatctt
gggccagaaatgaaatcaacaggtgaagtaatgggaagcgaccatacttttgcgaaagct
ctttataaagcttttgccggagctaagatgcaactacctgaaaatggaaatgttttgtta
acaattgaagacaaggataaagaaaagattctcccaattgcaaagagatttgcaagaatt
ggttatcgaatttttgctactaagggtacagcagacttcttaaagaataatgggttacat
gttgatcttgtaactaaagttcatgaaagcgaaaatgcagatgacaatatcttaaatgaa
ttaagagagggaagaattgacttagtgattaatacgatggggcatgatattgagaagaat
tctgacggctttattatcagacaaatggctatacaacagaatgtcccattattgacagca
ctggacacagctgacgcacttttaacatctcttgaaaataggtcatttgcaacagacgct
ttaaaatag

KEGG   Lactobacillus johnsonii NCC 533: LJ_1277
Entry
LJ_1277           CDS       T00158                                 

Definition
(GenBank) carbamoylphosphate synthase small subunit
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00240  Pyrimidine metabolism
ljo00250  Alanine, aspartate and glutamate metabolism
ljo01100  Metabolic pathways
ljo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LJ_1277
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ_1277
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     LJ_1277
SSDB
Motif
Pfam: CPSase_sm_chain GATase Peptidase_C26
Other DBs
NCBI-ProteinID: AAS09098
UniProt: Q74J33
LinkDB
Position
complement(1207349..1208437)
AA seq 362 aa
MKRYLILEDGSIYEGEGFGADCESSGEVVFTTGMTGYQEAITDQSYADQILVFTNPLIGN
YGITLADYESLEPQIKGVICHQVARHPYNWRMQTTLPEFLKQLNIPGLQGVDTRELVKKL
RIHGTLKGRITDSKENAVSIAQELKQKNITHGVISRVSTKNSYPVPGSKRNIVVIDFGIK
HSILRELAERDCNCIVLPYTATAEEILNLNPDGVLLSNGPGNPEEMLMAAKMVQEVEKHV
PLFGICMGHQVFALANGASTYKMKFGHRGFNHPVREIATGNIGFTSQNHGYAVDPKSIDK
ENLMITHVEVNDGTVEGLRHKKYPAFSVQFHPDATPGPHDEDSLFDDFMSMIDQRKEEER
HA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgaaacgctatttaattttagaagatggtagtatttatgaaggcgaaggctttggagct
gattgtgaaagtagtggtgaggttgtttttacaacagggatgacgggctatcaagaagca
attacggatcaaagttatgccgatcagattttggtttttactaatcctttaattggaaat
tatgggattactttggctgattatgaatcacttgagccacaaattaagggcgttatttgc
caccaagtagcacgtcacccatacaattggcgtatgcaaacaaccttgccagaattttta
aaacaattgaacatccctggcttgcagggagttgatacccgtgaattggttaagaaatta
agaattcacggtaccctaaaaggaagaattactgattcaaaggaaaatgcagtaagtatt
gctcaagaattaaagcaaaaaaacattacccacggtgtaatcagccgtgtttcaacgaag
aactcttatccagtacctggctcaaaaagaaatatagttgttatcgactttggtattaag
catagtattttacgagaattagcggagagagactgtaactgtattgtcttaccttacact
gcaacagccgaagaaattttaaatcttaatccagatggtgtgcttttatcaaatggacct
ggaaatccagaagaaatgcttatggctgcaaaaatggtccaagaagttgaaaaacatgtt
ccgctatttggaatttgtatgggccatcaagtctttgcactcgcaaatggggctagtacc
tacaaaatgaaatttggacaccgcggctttaatcatcctgtaagagaaattgccactggt
aatattggttttacttctcaaaatcatggttatgcggtagatcctaaatctattgataaa
gaaaatttgatgattactcatgttgaagtaaatgatggcacggttgaaggattacgtcat
aaaaaatatcctgccttttcagtccaatttcaccccgatgcaactccaggccctcatgat
gaagactcattatttgatgattttatgtcaatgattgaccaaagaaaggaagaagagcgt
catgcctaa

DBGET integrated database retrieval system