KEGG   Lactobacillus johnsonii NCC 533: LJ_1401
Entry
LJ_1401           CDS       T00158                                 

Definition
(GenBank) L-asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00250  Alanine, aspartate and glutamate metabolism
ljo00460  Cyanoamino acid metabolism
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ_1401
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    LJ_1401
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     LJ_1401
SSDB
Motif
Pfam: Asparaginase Asparaginase_C
Other DBs
NCBI-ProteinID: AAS09167
UniProt: Q74IW5
LinkDB
Position
complement(1274873..1275898)
AA seq 341 aa
MQKKILLLSTGGTIASVVSEAGLVPKESGEQLINMLGELPYDITVEDILQLDSSNIQPEE
WKLIAEKIYENRNKYDGIVVSHGTDTMAYTASMLSFMLQNINIPVVLTGSQVPINVVLSD
APDNLKLAFAAAASCHPNIYLAFDRKVMLGCRSVKVRTINFDAFESVNVPPVARVTSDGL
VFSDQNVPKNTKDMKDTTLNTSINPHVSLVKLFPGFDPNLLFAMVESGCQGIVIEAYGLG
GMNYIRRNMVAAIGKLIRRGIPIIATSQCLYERSDLTKYEVGREALLEGAISARDMTSES
AITKLMWGLGQNWDVHQISDFFNTDVAGEVTIEKDDNLQID
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcaaaagaaaatattattgctttcaacgggtggaacaattgcgtcagttgtttcagaa
gctgggttagtgcctaaagaatctggtgagcagttaattaatatgttaggggaattacct
tatgatattactgtcgaagatattctccaacttgattcatctaatattcagcctgaagaa
tggaaattgattgctgaaaaaatttatgaaaatcgaaataagtatgatgggattgtagta
tctcatggtactgataccatggcctatacagcatccatgctttcttttatgttacaaaat
attaatattccggttgttctaactggaagccaggttccaattaatgttgtattgagtgat
gcaccggataatttaaaattagcttttgcggcagctgctagttgtcatcctaatatttat
ttagcctttgatcgaaaagttatgctggggtgcagaagtgttaaagtaagaacgatcaat
tttgatgcttttgaaagtgttaatgtaccaccagtggctcgggtaacatctgatggccta
gtattttctgaccaaaatgtacctaaaaatacaaaagatatgaaagatacaactttaaac
actagcattaatcctcatgtttctttagttaaactattcccgggttttgatcctaatttg
ctatttgcaatggtcgaaagcggatgtcaaggaattgtaattgaagcgtatggtttaggc
gggatgaattacatccgcagaaatatggtagctgcaattggaaagttgattagaagagga
ataccgattattgcgacgagtcaatgcttatatgagcgaagtgatcttacaaaatatgaa
gttgggagagaagcgctgcttgaaggagcaattagtgctcgtgatatgacttcagagagt
gcgattactaaactgatgtggggattaggccaaaactgggatgttcaccagatttctgat
ttttttaatactgatgtagctggtgaggtaacgattgaaaaagacgataatttacagata
gattaa

DBGET integrated database retrieval system