Lutra lutra (Eurasian river otter): 125109538 Help Entry 125109538         CDS       T08100                                  Name (RefSeq) somatoliberin-like   KO K05260   growth hormone-releasing hormone Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04080   Neuroactive ligand-receptor interaction llv04081   Hormone signaling llv04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     125109538    04081 Hormone signaling     125109538  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     125109538  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125109538 Cytokines and neuropeptides [BR:llv04052]  Neuropeptides   GPCR binding    125109538 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  125109538 NCBI-ProteinID:  XP_047602520 LinkDB All DBs Position 9:complement(122225575..122229692) Genome browser AA seq 104 aa AA seqDB search MLLWVFFLVILTLSSDSHSFPPSLPLRVPRYADAIFTNSYRKVLGQLSARKLLHDIMNRQ QGEKNREQGAKARLGRQVDSMWAGAKQTPLESALAAMLLKQRNS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtgatcctcaccctcagcagtgactcccactctttc ccaccgtccctgcccctcagagtccctcggtatgcagacgccatcttcaccaacagctac cggaaggtgctgggccagctgtcagcccgcaagctactgcacgacatcatgaaccgccag cagggagagaaaaacagggagcaaggagcaaaggcacggctcggtcgtcaggtggacagt atgtgggcaggcgcaaagcagacgcccctggagagcgccctagcggccatgttgctgaag cagaggaattcctga

DBGET integrated database retrieval system