KEGG   Liquorilactobacillus nagelii: BSQ50_10325
Entry
BSQ50_10325       CDS       T06235                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lng  Liquorilactobacillus nagelii
Pathway
lng00550  Peptidoglycan biosynthesis
lng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lng00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSQ50_10325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lng01002]
    BSQ50_10325
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lng01011]
    BSQ50_10325
Enzymes [BR:lng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSQ50_10325
Peptidases and inhibitors [BR:lng01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BSQ50_10325
Peptidoglycan biosynthesis and degradation proteins [BR:lng01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BSQ50_10325
SSDB
Motif
Pfam: Peptidase_S11 Beta-lactamase2 PBP5_C Beta-lactamase ADC DUF305
Other DBs
NCBI-ProteinID: AUJ32897
UniProt: A0A3Q8CVE5
LinkDB
Position
complement(2136259..2137602)
AA seq 447 aa
MLFSKAKKFLIGLVTATTAFAALATTGAAITQAQAATVSDTPASGLNLDVKAAIAVDANT
GQIIYSKNASQPLAIASMSKLISIYLVLQAIKQGKLSWNEKIPVDEASYKVSQNTSLSNV
PLLKGHKYTVKQLYQASLIYSANGAVMTLANAVAGSQKAFVDQMRAQLKKWGINDGEIYT
VAGLPNSDVGSAKYPGTANSAENKLSAVDMATVARNLLKAYPEVLQTTSIARMKFNNGTT
ETQMENWNWMLKGLAKSYTELPVDGLKTGTSDSAGADFTGTVHKDGHRIITVVLGAQHKN
DQDASRFVQTQKLMSYVYDNFTYTKINAGKSSKGANYLPVYHGKQLTAQVVTGENSNIWI
KRGLTTSNLQVKLTGNKKLYKNGGLEAPIAKNKQVGNLALTIKGQKLQFLNGDTSLNLTA
TNPQAIQKANIFVIMGRAIKNFFTNLF
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgttatttagtaaggcaaagaaatttttgattggtttggtaacagcaacgacagcgttt
gctgccttggcaacaactggagcagcaataactcaagctcaagcagctacagttagtgat
acaccggcatccggattgaatttagatgttaaagctgcaattgcagtcgatgcaaacaca
ggacagattatttatagtaagaatgcttcacagcccttggcaattgcttcaatgtcaaag
ctgatttcaatttatctagttttacaagcaattaaacaaggaaaattatcttggaatgag
aagattccggttgatgaggcatcatataaagttagccaaaacacctcattatcaaatgtt
cctttgcttaagggtcataaatacacggttaagcaattgtatcaagctagtttaatttat
tcggctaacggagcagttatgacattagctaatgctgttgctggttcgcaaaaggctttc
gttgatcagatgcgagcacaactgaaaaaatggggcattaatgacggcgagatctatacg
gtagctggtttgccaaatagtgatgttggcagtgctaaatatccaggaaccgctaatagt
gctgaaaacaaactttcagcagttgatatggcgaccgttgcccgtaatttattaaaagct
tatccagaggttttgcaaactaccagtattgcccggatgaaattcaacaacgggacaaca
gaaactcaaatggaaaactggaactggatgttaaaaggtttagctaaatcatatacagag
ttgccagttgatggtttgaagactgggacttctgattcagctggagctgactttactgga
acagtccacaaagatggtcatcgaattattacggttgttttaggtgcacaacacaaaaac
gaccaagatgcttcacgttttgttcaaacgcagaagttaatgtcatatgtttatgataat
tttacctatactaagattaacgctggtaaaagttcaaagggtgctaattatttgccagtt
tatcatggtaagcaattaactgcccaagtggtaactggtgaaaatagtaacatttggatt
aaacgtggcttaactaccagcaatttacaagttaaactaactggtaataagaaactttat
aaaaatggcggtctagaagcaccaattgctaaaaacaaacaagttggtaacttggctttg
acaattaaaggtcaaaaattacaatttttgaatggtgatactagtttgaacttaacagct
accaacccacaagcgattcaaaaagctaatatctttgttatcatgggacgagcaattaag
aatttctttactaatcttttctag

DBGET integrated database retrieval system