Lynx rufus (bobcat): 124529235 Help Entry 124529235         CDS       T08475                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism lruf  Lynx rufus (bobcat) Pathway lruf04613   Neutrophil extracellular trap formation lruf05034   Alcoholism lruf05202   Transcriptional misregulation in cancer lruf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lruf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124529235  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     124529235   09163 Immune disease    05322 Systemic lupus erythematosus     124529235   09165 Substance dependence    05034 Alcoholism     124529235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lruf03036]     124529235   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124529235 Chromosome and associated proteins [BR:lruf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124529235 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124529235 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  124529235 NCBI-ProteinID:  XP_046959024 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MCSQLLTKTARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREI RRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCA IHAKRVTIMPKDIQLERRIRGERA NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgtgctcccaactcctcacaaagacggctcgcacgaagcagacggcgcgcaagtcgacg ggcggcaaggccccgcgcaagcagctggccaccaaggcggcccgcaagagcgcgccggcc accggcggcgtcaagaagccgcaccgctaccggcccggcacggtggccctgcgcgagatc cgccgctaccagaagtccaccgagctgctcatccgcaagctgccgttccagcggctggtg cgcgagatcgcgcaggacttcaagaccgacctgcgcttccagagctcggccgtgatggcg ctgcaggaggcgtgcgaggcctacctggtggggctcttcgaggacaccaacctgtgcgcc atccacgccaagcgcgtcaccatcatgcccaaggacatccagctggagcgccgcatccgt ggggagcgggcctaa

DBGET integrated database retrieval system