KEGG   Lachancea thermotolerans: KLTH0C03564g
Entry
KLTH0C03564g      CDS       T01117                                 
Name
(RefSeq) KLTH0C03564p
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
lth  Lachancea thermotolerans
Pathway
lth04111  Cell cycle - yeast
lth04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    KLTH0C03564g
   04113 Meiosis - yeast
    KLTH0C03564g
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 8291244
NCBI-ProteinID: XP_002552380
UniProt: C5DDT1
LinkDB
Position
C:complement(308883..310586)
AA seq 567 aa
MLKVVDLNVITTEDELLPIMKSVLRNESVILLKNYANMETLRTLSGILAKDSPDDLAGFD
SNFVGCTKLENGVSVEQFIGSADSVGVQNTALSKMSSRLVKIAIFFARICLAAVNFEKEE
AVLNEHNSAVKVTRYHKPISKSVLDLEFDYEDEYVLHNSPGIITVFPVAHGVQFKEHGKW
APLQDPDSILIQTGTLLSHFSNGMHASDSVKISTTNTTYLTIFPALESFVNGQTVSRLLL
LNQLQEFPQVAEVLYPKEMAQQNLVKRVDFCKGIFNVTDSVMSLYCVSRSLTSSNPELDK
LLPQISNMLKKKVSQDDFLRMMYIWDEAYILEVGNDHEITIGLPPSGLLNTLTNKSRKLR
YTELADKWLSDAILQPQILANVPALKIRKRRASSTSDIQGGQVQELHAPRALAQPKKNRT
RGYIANTKEKFMFKELSNNENGESLLERIREKERRAAALLSQRERQYEQFLNVKTFQVFD
ILNSLTPDRPYTTTHLISLIVDSLVDSNNPIGERETYDILLRLQALLKDKIKIIEAEGSL
KVFRWPSLDRLVLEKRIKESNEQLFNG
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgctcaaggtggtcgatctcaatgtcataacgaccgaagatgagctcttacccataatg
aaaagtgttttacgaaatgaaagtgtcatattactgaaaaattatgcaaatatggaaaca
ctgcgaacgctatctggcatactagcaaaagattctcctgatgatttggctggcttcgac
agtaactttgttggctgtaccaagctcgaaaacggcgttagtgtggagcagttcattggc
agcgcagacagcgtgggcgtacaaaacactgccttgagtaaaatgagctcaagactagtc
aaaatagctatcttctttgcccgtatttgccttgctgcggtaaattttgagaaagaggag
gctgtactcaacgagcataatagcgctgtgaaggttacgcggtaccataaacccatctcc
aagtctgtgctagatttggagtttgactatgaagatgaatatgttttacacaattcccct
ggcatcataacagtatttcctgttgcccacggtgtacaattcaaggaacatgggaaatgg
gcaccattgcaagatccagacagcatcttgatccaaacaggtactttactctcacatttt
tccaatggaatgcatgcatcagattctgttaagatttcgactacaaatactacatacctg
acaatattcccagcattagagtcttttgtcaatggacagacggtttcaaggttgctcttg
ttgaaccagcttcaagagtttcctcaggtcgcagaggttttatatccaaaagagatggct
caacaaaaccttgtcaaaagagttgatttttgcaagggcatcttcaatgtcactgattct
gttatgtcattgtactgtgtttctaggtccctaacatcgtccaacccagagctggataaa
ttgttaccccaaatctccaacatgttaaagaaaaaggtctcgcaagatgactttctcaga
atgatgtacatatgggatgaggcttacattctagaggtcggtaacgatcatgagattacg
attgggctgccgccctcgggactattaaacacactgacaaacaaatcccgaaagctgaga
tacactgagctggcagataaatggctttctgatgcaatcttacaaccacaaatacttgca
aacgttcctgctttaaaaatacgaaagaggagagccagcagcacctctgatatccaaggg
gggcaggttcaggaattgcacgctcctcgtgcgttagcccaaccgaaaaagaatcgaaca
agaggttacattgcgaacacgaaggagaagttcatgttcaaagagctctcgaacaatgaa
aacggtgagtctctattggaaaggattcgcgaaaaagaacggagagccgctgcactttta
tcccagagagaaaggcaatacgaacagtttctcaatgtcaagacatttcaagtgtttgat
attctaaactctctgacccctgacagaccatataccactacacatttgatatctttgatc
gttgacagcttggtcgatagtaataatccaattggcgaaagagaaacgtatgatatactt
cttcgactacaagctctgttgaaggataaaatcaaaatcattgaagcggagggatccctc
aaagttttcagatggccaagtcttgaccggctagtccttgaaaagagaataaaagagtca
aacgaacagttgttcaacggctag

DBGET integrated database retrieval system